SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157162557|ref|YP_001459875.1| from Escherichia coli HS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157162557|ref|YP_001459875.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.05e-110
Family FMN-linked oxidoreductases 0.00000000000972
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.02e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.97e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157162557|ref|YP_001459875.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia coli HS]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A1X7ATQ3 S1HVI0
gi|157162557|ref|YP_001459875.1| 331112.EcHS_A3263 WP_000121450.1.100159 WP_000121450.1.10094 WP_000121450.1.10233 WP_000121450.1.11418 WP_000121450.1.13664 WP_000121450.1.13824 WP_000121450.1.13974 WP_000121450.1.1655 WP_000121450.1.17150 WP_000121450.1.17831 WP_000121450.1.20691 WP_000121450.1.22783 WP_000121450.1.27691 WP_000121450.1.30391 WP_000121450.1.33751 WP_000121450.1.35180 WP_000121450.1.36531 WP_000121450.1.38544 WP_000121450.1.49236 WP_000121450.1.5272 WP_000121450.1.53244 WP_000121450.1.53545 WP_000121450.1.56436 WP_000121450.1.6993 WP_000121450.1.71522 WP_000121450.1.75672 WP_000121450.1.76547 WP_000121450.1.81127 WP_000121450.1.84004 WP_000121450.1.84972 WP_000121450.1.86189 WP_000121450.1.86760 WP_000121450.1.90865 WP_000121450.1.93309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]