SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157825490|ref|YP_001493210.1| from Rickettsia akari str. Hartford

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157825490|ref|YP_001493210.1|
Domain Number 1 Region: 23-215
Classification Level Classification E-value
Superfamily Cytochrome c 3.2e-71
Family Cytochrome bc1 domain 0.00000318
Further Details:      
 
Domain Number 2 Region: 216-251
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0000183
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157825490|ref|YP_001493210.1|
Sequence length 251
Comment cytochrome c1, heme protein [Rickettsia akari str. Hartford]
Sequence
MQTKLLISIIILLTSCLSLANEEALHPKKMQWSFDGVFGTVNRAAAQRGFQVYKEVCSIC
HGLNNLYYRNLKDIGFSDDEIKEIAKGYTIKDGPNDDGEMFDRHALPSDRFVPPYPNEQA
ARAANNGAHPPDLSLIIKARHDGANYIYSLLTGYTEPPADFKLMQGAHYNPYFPSEQIAM
PPPLRDGQVTYIDGTNASVEQMSHDVAVFLQWAAEPEMEHRKSMGLKVMMFLVVFTIFFY
IAKNRIWSNLK
Download sequence
Identical sequences A8GMS7
gi|157825490|ref|YP_001493210.1| WP_012149336.1.98304 293614.A1C_01955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]