SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000006558 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000006558
Domain Number 1 Region: 238-479
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.44e-59
Family Decarboxylase 0.00000046
Further Details:      
 
Domain Number 2 Region: 6-198
Classification Level Classification E-value
Superfamily PRTase-like 3.93e-43
Family Phosphoribosyltransferases (PRTases) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000006558   Gene: ENSLOCG00000005441   Transcript: ENSLOCT00000006566
Sequence length 485
Comment pep:known_by_projection chromosome:LepOcu1:LG12:11037005:11041945:-1 gene:ENSLOCG00000005441 transcript:ENSLOCT00000006566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAKMETLDELIIKLYEVQAVKFGTFQLKSGITSPIYFDLRVIVSYPALLNQVSSLLFQCA
QGAEVKFNSVCGVPYTALPLATIMCSAHQIPMLIRRKEAKDYDKGTKRLVEGTIHPGETC
LIIEDVVTSGGSVLETAEVLQTEGLKVTDAIVLMDREQGGRSRLEQKGIRLHAVCSISKL
LDVLHKTGKIDAEVVRSVSRFIQENRAFESPKGNSAAPAKEEDENLSYGARAGLPSVHPL
AARLLKLMEKKKTNLCLSADVTDSEELLNVADTLGPYICLLKTHVDILQDFQPDFVKALK
ALADKHEFMLFEDRKFADIGNTVKHQYEGGVYQISTWAHVVNAHAVPGPGVVKGLSEVGR
PLNRGCLLIAQMSSQGSLATGDYTQATVKMAEEHSHFVFGFISVSKISSKPEFLHLTPGV
QMQSGGDALGQQYLNPEEVLFKRGSDIIIVGRGILMAPDRVKAAEDYRTAGWAAYLKRIS
GPQTP
Download sequence
Identical sequences W5MDU9
ENSLOCP00000006558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]