SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000009962 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000009962
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily BRCA2 helical domain 4.84e-76
Family BRCA2 helical domain 0.000000369
Further Details:      
 
Domain Number 2 Region: 357-491
Classification Level Classification E-value
Superfamily BRCA2 tower domain 5.36e-46
Family BRCA2 tower domain 0.0000327
Further Details:      
 
Domain Number 3 Region: 190-327
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.26e-40
Family Single strand DNA-binding domain, SSB 0.00000633
Further Details:      
 
Domain Number 4 Region: 577-713
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.8e-39
Family Single strand DNA-binding domain, SSB 0.00011
Further Details:      
 
Domain Number 5 Region: 329-357,493-574
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-31
Family Single strand DNA-binding domain, SSB 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000009962   Gene: ENSLOCG00000008205   Transcript: ENSLOCT00000009974
Sequence length 871
Comment pep:known_by_projection chromosome:LepOcu1:LG3:13357730:13380925:1 gene:ENSLOCG00000008205 transcript:ENSLOCT00000009974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQNLDFARGMQEMRIRKKKRQTIRPLPGSLCLTKTSGVSRVSLRAAVGGKSPAQHTQQQ
LYVCGVNRCVLEISSENAESFRFSCRDHFGIEFFSAGNGVQLADGGCLIPDNKGTAGKEE
FYRALCDTPGVDPKLISESWVYNHYRWIVWKRAAMERAFPLEMGSRCLTPEQVLLQLKYR
YDLEIDNSQRSALRKIMERDDTPAKTLVLCVCRIVSMGSLQAHDTPGNKALPYAKAKTDG
PVGVIEVTDGWYAIKALLDAPLTAILRKGRLAVGGKIVTHGADLIGCQDACSPLEAPEAL
MLKICANSTRLARWDTKLGFHRDPRPFHVPLSSLFSNGGRVGCVDVVVLRTYPIQWMEKK
ADGVFVFRGDRAEEREARRHNENKQKTMEALFAKIQSEFEKEQEGKKKSNRRQRFSHQEI
QALQEGEELYEATESDPVCLEACLSEQQLMTLNNYRRALNERKQTKLQEEFQKAIRSAQD
RENSCPERDVTPVWKLLVVDCKNLQNNTAYFLNIWRPSTEVCSLLKEGCRYKIYQLATSE
TKRRIGNAAVQLTAMKKTQFEQLQVPPELLCQLYASREAVSFRSLLSPRFQPVCGEVDLV
GYVISITGKQGGAPVVYLVNENRDFVAVKCWVGLSQLALEDIVQPRALLAVSNVQARPSP
AAAVPTAYAAELSVFSANPKETHLQAACTLLRSAAQGIECFFEAAEEKLSKLIKEDFPCQ
SLKDLSSIPKTPIMKPDVQRESSNLMISFILLLPSPQVPGRSPQQSLCAFEHLTPTCGKP
PLHAGRSDDKGPKSLKRKRGLIYLSRIPSPPPLAPLRSPCVNKTFQPPRRCASPLAAARG
KEECRSPGPAPEAGGEWVKDEELAQINTQDL
Download sequence
Identical sequences W5MNK3
ENSLOCP00000009962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]