SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016290 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016290
Domain Number 1 Region: 31-169
Classification Level Classification E-value
Superfamily dUTPase-like 3.93e-48
Family dUTPase-like 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016290   Gene: ENSLOCG00000013224   Transcript: ENSLOCT00000016320
Sequence length 174
Comment pep:known_by_projection chromosome:LepOcu1:LG3:39600637:39606259:-1 gene:ENSLOCG00000013224 transcript:ENSLOCT00000016320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPISRLEGTAVTEAVTASSPAKRQRTDTTHEIKVVLKFAKLSENATTPTKGSSKAAGYDL
YSAYDYSIPPLEKTVVKTDIQIAVPPGCYGRVAPRSGLAAKHFIDVGAGVVDEDYRGNVG
VVLFNFSKETFEVKKGDRVAQLICERICYPEIEQHETLDETERGAGGFGSTGRN
Download sequence
Identical sequences W5N6N1
ENSLOCP00000016290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]