SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000001722 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000001722
Domain Number 1 Region: 369-542
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000589
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number 2 Region: 538-750
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000647
Family Tropomyosin 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000001722
Domain Number - Region: 210-310
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00418
Family Formin homology 2 domain (FH2 domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000001722   Gene: ENSLOCG00000001500   Transcript: ENSLOCT00000001727
Sequence length 811
Comment pep:known_by_projection chromosome:LepOcu1:LG17:550958:571733:1 gene:ENSLOCG00000001500 transcript:ENSLOCT00000001727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QREIAKLQETVKSLKAETESSKASCDRLQASLNASEQENGLLHSLLDRQQAEKAKLSKQV
ETLCLSEKEGVLGAESGRKPPRKTGSPSRLGSFVKSPEEDRDYFTQEAEAVRRRKRMLKN
RTQSPTRSTSRGRGGSYDSELMRILRERDELQAMLDKYERHLSEIQANIKVLTADRDKTN
MLYQQAQEEIARLRREVIKSPRAPRSSLTAQSILRRVEAERDETVADLRRMTNERDSLRE
RLKISQESAINERAHLEQRVEDLQSAFLILEKERGEQKTRQALMKDTMLSLEEEVRALSR
RLDTTEEELTRTKTECSMLRYGGTHACTHPXQATQDKHKQLDQRNDTVICLMERALIDTS
VEITSLREEVSTLQVTTAELDKEKDVLESELDDKIELISSLRGQLEEKNKSLQNLKLTIE
EVEATASSTKEELSSREREVSSVRRQLDSVREELGAAGKARETLARECVQLREDLSKAKL
ENQALQLRLDDYGQEMEDLRLKMQDYSSDATRTQTLLESQEKEIREQQESCHRATAQAKS
WEDKARQAEAEASSLRLELLSGDSERRRLKDKAEALEGSLEEALSAERVSRSQLSQLNRS
LQRLEEELRQAQAERATAETELESTRDLCVKLDASKEAVNTKVCSAVARVRSVLGDLESY
HADGELLRQQLASERLSMKNLESLLVANREKEFQIQLHTQEKQTEIQLLRDKLSLADSKA
VTQSREVAQARSRASQLEAELEKTKRQLSTERFERERAVQELRRQGLSSSSPTRRSLSPR
ASWSPERSYLSPLDRSSLDRSPDRSVTFRDF
Download sequence
Identical sequences W5M015
ENSLOCP00000001722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]