SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000002326 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000002326
Domain Number 1 Region: 570-667
Classification Level Classification E-value
Superfamily TAFH domain-like 1.26e-35
Family TAFH domain-like 0.0000405
Further Details:      
 
Domain Number 2 Region: 825-873
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000691
Family TBP-associated factors, TAFs 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000002326   Gene: ENSLOCG00000001983   Transcript: ENSLOCT00000002331
Sequence length 1041
Comment pep:novel chromosome:LepOcu1:LG23:2758099:2848843:-1 gene:ENSLOCG00000001983 transcript:ENSLOCT00000002331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASDPLEDMLFSEVDEKAVSDLVGSLESQLAGQSNPAAPHTETRSAGVTGAANHHLGR
MLPAQVDTILEQQQQQQGQHKAGVNQEPNCKALSSGKTVIPSSLSSIPPFEEASITSGTG
VNASSSGLPSHGASNITTVSAPGLVTLPPPLVSISPGSRGTVLGSGGAATAADPLKNHLT
STIRTAPAGIQSLNGNGGVAVNSPVNPAAPAAVGFPAAAGAVTLVNNVVNSAVPSPTGAA
SSGLAGAPCASAPAFSAAQPGVAPDGSGTLTIALQRPPGHLAASVAQNGNGAPALVQQVA
RTGPPAAAVAQLANHRKGGDGSDPPADSPAPSKIILPTQPCVVSSLANPVSSPAPAVNPP
ASQPPSSAASSAPAASSPAAKPAVNITTVGVVRPGTPSPSAGMSASTQPQPLRPGVGATQ
RIVAPQLIVRPPQQTTIQLPPGFTIPPGMVLVRTEMGQLVMVPQQALAQAQAQAQAQAQG
QAHNSISPRPAAPTSGPTFRVTTTQKAAVVTAAVATAAAQQPLTVIAGGQNPPQAQPQPA
PQPALAQQGAAPTALASAPAPGASVVSQEMQENVKKCKNFLATLIKLASHNSPSPETSRN
VKALVQDLLDAKIEPEEFTNRLQSELKSSPQPYLVPFLKKSLPALRQSLLNSQQSLMQTQ
QPLQQVKPAPGTPQATAGTVPTIVAGPTVRVRHPNSVGNTVPSILPHAPGTAHTSHLAIK
RAPGVQSSQVRMPMVITQTVRPQGTVGKAPTIQASKGPGGFAVQVSANQKNKLNDPGGGS
FRDDDDINDVASMAGVNLNEESARILATNSDLVGTQIRSCKDEAFLPSGLLHKRILETAK
KFGVTEVPAEAVNFISHATQERLRTVLEKVTIIAQHRMETYKDDEWYEQATDVRSQLKFF
EQLERIEKQRKDEEEREILLKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLT
ALAAIGPRKKRKLDSPGAAPPGAEVSGSSSGSPAGSATPAASSRQYPRQRITRVSLRDFI
FYMEQERETAHSLLLYRALLK
Download sequence
Identical sequences W5M1R8
ENSLOCP00000002326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]