SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000003061 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000003061
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-55
Family YWTD domain 0.00000406
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 331-567
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-51
Family YWTD domain 0.00000206
Further Details:      
 
Domain Number 4 Region: 934-1192
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-39
Family YWTD domain 0.0000562
Further Details:      
 
Domain Number 5 Region: 1284-1319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1244-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 889-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000594
Family EGF-type module 0.036
Further Details:      
 
Domain Number 8 Region: 588-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000599
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1322-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 285-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000407
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 1202-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00002
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000003061   Gene: ENSLOCG00000002586   Transcript: ENSLOCT00000003067
Sequence length 1602
Comment pep:known_by_projection chromosome:LepOcu1:LG27:5538126:5606746:-1 gene:ENSLOCG00000002586 transcript:ENSLOCT00000003067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAFLAGLLLYSLFCVLDGSPLLLFANRRDVRLVDAGLGRPESTVVVSGLEDAAAVDFLF
SEGLIFWTDVSEEAIKQTYYNQSGNVQSVIVSGLDSPDGLACDWLGKKLYWTDSETNRIE
VANLNGTSRKVLFWQNLDQPRAIALDPAHGYMYWTDWGEEPRIERAGMDGSRREVIVDSD
IYWPNGLTIDLEEQKLYWADAKLSFIHRANLNGSNRQTVVEGTLTHPFALTLSGETLYWT
DWQTRSIHACNKNTGERRREILNSIYSPMDIQVLGQERQPNIPTPCFHNNGGCTHLCLLS
PEEPFYSCACPTGVQLQEDGKTCKPGAQEVLLLARRTDLRRISLDLPDFTDIVLQINDIR
HAIAIDYDPVEGYVYWTDDEVKAIRRAQIDGSGAQTLVTTEVNHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTSRRILISENLDEPRAIVLDPIRGYMYWTDWGEKPKIERANLDGSD
RVILLNTSLGWPNGLAIDYAAGKLYWGDAKTDRIEVINIDGTERKTLLEDKLPHIFGFTL
LGDYIYWTDWQRRSIERVHKTKATREIIIDQLPDLMGLKATRVTEAFGTNSCTENNGGCS
HLCFYRPQGLRCACPMGLELLNDMKTCIVPEAFLLFTTRADIRRISLGTTNNDVAIPLTG
VKEASALDFDVSDNRIYWTDVSMKTISRAFMNGSSVEHIIEFGLDYPEGMAVDWMGKNLY
WADTGTNRIEVARLDGQYRQVLVCKDLDNPRSLALDPAKGYMYWTEWGGKPRIVRAHMDG
TNIVTLVDKLGRGNGLTIDYVDQRLYWTDLDTCMIESSNMLGQEREIIADDLSHPFGLTQ
YRDFIYWTDWTLQSIQRADKSNGQNRTEIQGHLEYVMDILVFHSSRQDGWNECVQNNGQC
AHLCLAVPEGYKCRCASHYTLDANGKNCSSPSSFLLFSQKAAISRMVLGEQSPDIILPIH
VLRNVRAISYDPVDKLIYWVDGRQNIKRAMDDGSQAFVVVSSSGHLQNPDKQPHDLSIDV
FSRTVYWTCEATNTINVHRLDGKSIGVVLRGEQDRPRAIVVNAERGYMYFTNMQERSAKI
ERASLDGTEREGLFTTGLIRPVALAVDNKLGKLFWVDADLKRIESSDLSGANRITLQDSN
ILQPMGLTVLGEHLYWIDRQQQMIERVDKLTGEKRTRIQGRIFHLTSIHAVEDMDATEFA
SHPCSRDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPEQFTCATGEIDC
IPMDWRCDGFAECDDNSDEEDCPVCSAFQFQCEKGQCIDARLRCNGEADCADSSDEQDCD
TICRPNQFRCRTNQCILKKQQCDSFSDCSDDSDELFCEYNSPPSDLQAHSSTIGPVIGII
LSVFVMGGMYFVCQRVVCRRYKGPNGAFPTEYISGTPHVPLNFIAPGSSQHGTFTGISCG
KSVRSSMSLMGSSGSGAPLYDRNHVTGASSSSSASTKGTFYPQILNPPPSPATDRSLYNT
EIFYSSNSPSTTRSYRPYLLRGIAPPTTPCSTDVCDSDYTTSRWKTNKYYIDLNSDSDPY
PPPPTPRSQYLSAEESCPPSPSTERSYFHLCPPPPSPCTDSS
Download sequence
Identical sequences W5M3V3
ENSLOCP00000003061 XP_006642533.2.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]