SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004271 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004271
Domain Number 1 Region: 646-814
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.69e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000796
Further Details:      
 
Domain Number 2 Region: 86-287
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-41
Family DBL homology domain (DH-domain) 0.0008
Further Details:      
 
Domain Number 3 Region: 302-370,429-463
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-19
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 4 Region: 506-620
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000686
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004271   Gene: ENSLOCG00000003587   Transcript: ENSLOCT00000004279
Sequence length 862
Comment pep:known_by_projection chromosome:LepOcu1:LG22:4150188:4254747:-1 gene:ENSLOCG00000003587 transcript:ENSLOCT00000004279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEPMAGERSPCFSPLQCLLLSADFNYNTDGYDGDGTDEHKSQDGSETMPYIDESPTMSPQ
LSARGQDGEAVSPTPQALLIPGGDMDTEKGLEMRKLVLSGFLASEEIYINQLEALLLPMK
PLKATATTSQPVLTIQQIETIFYKIQDIFVVHKEFYDELYPNIQQWDNKVTVGHLFQKLA
SQLGVYKAFVDNYKVAVETARQCSQANIQFQKISENLKVKGPKDSKDCTTTVTMEALLYK
PIDRVTRSTLVLHDLLKHTPKDHPDFPLLQDALRISQNFLSSINEEIDPRRTAVTTPKGE
ARQLVKDGFLVEVSEGTRKLRHVFLFTDLLLCAKTKKMAVGKHQQYDCKWYIPLADLAFQ
TLDDTDVCPHVHTMSEEEIEEMKMKISVIKSDIQKEKKALKGQTRALDRLRKKMNEQESW
LLLHSPTIPFRIHNKHGKSYLFLLSSDYERSEWREAIQKLQKKDLQACLLSSVELQVLTG
SCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSATGFKESANLYCTLEVDSFGYFVSK
AKTRVFRDTTEPQWNEEFEIELEGSQCLRILCYEKCYDKSKLNKDDNEIVDKIMGKGQVQ
LDPQTVQSKNWHMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRER
SKVPFIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDTNTKDILVMLSDMDINAI
AGTLKLYFRELPEPLLTDRLYLAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLTLLE
HLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVETKGHINLASDIWSHDVMAQVQVLLYY
LQHPPISISELKRNTLYFSTDV
Download sequence
Identical sequences W5M7B3
ENSLOCP00000004271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]