SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004505 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004505
Domain Number 1 Region: 545-649
Classification Level Classification E-value
Superfamily TAFH domain-like 1.26e-35
Family TAFH domain-like 0.00000545
Further Details:      
 
Domain Number 2 Region: 819-867
Classification Level Classification E-value
Superfamily Histone-fold 7.53e-16
Family TBP-associated factors, TAFs 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004505   Gene: ENSLOCG00000003773   Transcript: ENSLOCT00000004513
Sequence length 1032
Comment pep:known_by_projection chromosome:LepOcu1:LG18:7571718:7596244:1 gene:ENSLOCG00000003773 transcript:ENSLOCT00000004513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFFNTEVDEKVVSDLVGSLESELTGSGHGNTDIRGQAVGNHIASPGVGGN
ASVQESKLGLAQDLAKAGAGVQGGVINNTRSQGSDMDATTGITSSAGSEASVGLSQGKTV
AVSAMVTAVPNHGAGNGKIGTSAVQTLNGSNVVMNSHNSGSAAVFPGTPVSSATTCSSSS
TAPAVTVVNNGPGSVVKGNVNAVLPSASSTVIQTSFVNAQNVVTSTVISSQATSLGSGPT
VTLVRPPMHTTGPGTTQNGSTNSTVLTSAVSVASLPAPVGSGISLQAPLLNSSPSPVSAG
AQVIKSESPKTIIQTTAQAVAPGVVANAGNLTLGQPMQNALQPGPPPQPSSAAAIGKSPV
LQNVARTSTPGAVVPGPVGIRTIAPQVLAPRLPHAPQNQPNIQNIQLPPGMVLVRSDSGQ
LLMIHQQTLAQMQAQSQSQSAMAPRPSTPTSTPPVQITSVQAPGTPIIARQVTPTTIIKQ
ASPAQTTVQATTTLQRPPVLQNPIVLGGTATATSIGAPSSVQPGASQRTVTGATGTPATT
ATETLENVKKCKNFLSTLIKLASSGKQSSETAANVKELVQNLLEGKIEAEDFTSRLYREL
NSSPQPYLVPFLKRSLPALRQLTPDSTAFIQQSQLQQPSTQATTTLTAVVLGSTVQRTAG
KTTATVTSTLHQPVISLAQPSHTKPGQPAPLILQSQQQGTMVRPQVTLTQTPMVTLRPPH
SRIMLSPQPVQVKQLQTVPMVKQTVLPGTKVSPACPALTSAAQKNKMKDAGGGSFRDDDD
INDVASMAGVNLSEESARILATNSELVGTLTRSCKDEAFLFTSSLHRRILDIGKKYGITE
LGPEVVNFVSHATQQRLQNVIEKVSEIAQQRNMSFKEDDRYEQVNDVRSQLKFFEQLDQI
EKQRKEEQEREILMKAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIG
PRKKRKLDSPGSGAGAEGSGSHASLPGSSSAGASRQFTRQRITRVNLRDLLFCLENERET
SHSHLLYRAFLK
Download sequence
Identical sequences W5M7Z7
ENSLOCP00000004505 XP_015220214.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]