SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000004523 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000004523
Domain Number 1 Region: 565-669
Classification Level Classification E-value
Superfamily TAFH domain-like 1.29e-35
Family TAFH domain-like 0.00000545
Further Details:      
 
Domain Number 2 Region: 839-887
Classification Level Classification E-value
Superfamily Histone-fold 7.53e-16
Family TBP-associated factors, TAFs 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000004523   Gene: ENSLOCG00000003773   Transcript: ENSLOCT00000004531
Sequence length 1055
Comment pep:known_by_projection chromosome:LepOcu1:LG18:7571741:7596244:1 gene:ENSLOCG00000003773 transcript:ENSLOCT00000004531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFFNTEVDEKVVSDLVGSLESELTGSGHGNTDIRGQAVGNHIASPGVGGN
ASVQESKLGLAQDLAKAGNRKCKRMHSLPCLPMCCDIFPSHSGLFPFQQGLECKDMDATT
GITSSAGSEASVGLSQGKTVAVSAMVTAVPNHGAGNGKIGTSAVQTLNGSNVVMNSHNSG
SAAVFPGTPVSSATTCSSSSTAPAVTVVNNGPGSVVKGNVNAVLPSASSTVIQTSFVNAQ
NVVTSTVISSQATSLGSGPTVTLVRPPMHTTGPGTTQNGSTNSTVLTSAVSVASLPAPVG
SGISLQAPLLNSSPSPVSAGAQVIKSESPKTIIQTTAQAVAPGVVANAGNLTLGQPMQNA
LQPGPPPQPSSAAAIGKSPVLQNVARTSTPGAVVPGPVGIRTIAPQVLAPRLPHAPQNQP
NIQNIQLPPGMVLVRSDSGQLLMIHQQTLAQMQAQSQSQSAMAPRPSTPTSTPPVQITSV
QAPGTPIIARQVTPTTIIKQASPAQTTVQATTTLQRPPVLQNPIVLGGTATATSIGAPSS
VQPGASQRTVTGATGTPATTATETLENVKKCKNFLSTLIKLASSGKQSSETAANVKELVQ
NLLEGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSTAFIQQSQLQQPST
QATTTLTAVVLGSTVQRTAGKTTATVTSTLHQPVISLAQPSHTKPGQPAPLILQSQQQGT
MVRPQVTLTQTPMVTLRPPHSRIMLSPQPVQVKQLQTVPMVKQTVLPGTKVSPACPALTS
AAQKNKMKDAGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDEAFL
FTSSLHRRILDIGKKYGITELGPEVVNFVSHATQQRLQNVIEKVSEIAQQRNMSFKEDDR
YEQVNDVRSQLKFFEQLDQIEKQRKEEQEREILMKAAKSRSRQEDPEQLRLKQKAKEITE
MQQQELAQMRQRDANLTALAAIGPRKKRKLDSPGSGAGAEGSGSHASLPGSSSAGASRQF
TRQRITRVNLRDLLFCLENERETSHSHLLYRAFLK
Download sequence
Identical sequences W5M815
ENSLOCP00000004523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]