SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000006630 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000006630
Domain Number 1 Region: 1630-1853
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000051
Family Tropomyosin 0.002
Further Details:      
 
Domain Number 2 Region: 1473-1667
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000034
Family Tropomyosin 0.001
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000006630
Domain Number - Region: 1253-1412
Classification Level Classification E-value
Superfamily Tropomyosin 0.00562
Family Tropomyosin 0.0089
Further Details:      
 
Domain Number - Region: 491-710
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000006630   Gene: ENSLOCG00000005485   Transcript: ENSLOCT00000006638
Sequence length 1985
Comment pep:known_by_projection chromosome:LepOcu1:LG14:10158103:10201198:-1 gene:ENSLOCG00000005485 transcript:ENSLOCT00000006638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEAEQSMQAEGLEAVIQKLEESVLNPDTSGDERSLTLRGHGRDSPATPVAARIRQIVT
RNLADQPAAGSPEVGASSSLQEENRLLKDLLSQTRADRDSLLLKQQVLTDRLERMQLLES
RDQNQESERRRFEEEERIYKQKLQAYQDGQQRQAQLVQKLQTKVLQYKKRCGELEHQVLE
RTSESEKLKSSLQAQLDSSEARLRRAEQEHSADLGNTLRQLEEEQSRCATLAQVNAGLRE
QLEQTSSANHQLAESVRRAKEEVEQRDARLRREQETSASRLSREQSRVLALWRQAASLRS
SVTQLRASADRSLSEMRVDCVDVSRRLHAACLSLETCLSQQTPTGQEVSALEQQLREKLK
EAMQLQSRWDGEKVELNSRILELTEMVKQLRGQNEEKEKSLAALKIALDKTEQSKAEEAS
EKESLRQDFESLQQILHNITQVAWGDSESAGSQGVSEPADSLRPPPSRHASPSRARSPLR
SGSPAQQDRALNAVQSALLRRQLQAQEMRTRLEAAQEQVATLRKQLLDGEAERRALEQRV
QQLRQERQQAELSGEETRRDAQRYRSSLDVIASEKGNLEKLILNLNQQIDSQLGEMEKLK
SANHDLQRQRDHLEQQREDLERERERGRKEMERGQKSLEQLEMKHSSLRKELVTVKEALS
QVTLQKEVLEDEKASLAQALSKVEVQSAEQELALAKLQSEEASLGDSLAKMGALSEGLAK
DKVELNRIILQMESEKAEQGERRREAELERAAGREEVSRLEQELQDLRAEKRALEVSQAH
LLEACQSLEHELRVIRQEKSQALGQHAQASRQRQALSDQLALSRREVESQAAALQRSVRE
REELAKDKAGLSVQLTSAERKARGLAQELAALRAEKESLETALFESQEQILALEAWRTQL
EGEQQNLQLANESLTREVARVRGEAELQVSRLGKEREQLEARLAQTEREAQSTLSSTERA
YQELLEREHKDKERACAELSAQREQAEQQLRGECEELRVRGQAEQQQLQEELARLQQQRD
DSLLQAESHKQQALSLKEAEKAVLAEKLASAQQEQVNVTMEMERVRREALSRQEQDKDTI
NGLNSELRALRTQFEEALGSHEGEVRRLNERIKELAQEREEALQEVERLKAELQAAEEGR
DGGRRELIELHRELRECGQERDAQRKEVLELRRALADETREKEAILNSNQELRSGVKMAE
SDRNSLRRANEEKEQKLAVLEECKASLQQEAAELRSSLRELERSRLQARRELQDLRRQVK
TLDSENVQRRKELDELRARVAQDGQREDELRREIFSLKQRILEGEASKEAELKEVAGLQR
RVLEMETQQRLQAEELESRARELQESGRRHKESTEQQEGARQRAEARLQELTLRLSVAEG
RAQELEEQLGQADSAKCDLEQRLTSLSSILRRTLGITRTGRSQTPGAHGRSPSPRRSLSP
MKGDSGDGLRCSTPCLSGSGSPLHSWGGDTDLDLDMVKAALRDFIQELREAQRDRDEAQV
QVLNLSRKIGELEGDRDRTNSRVQQLQKSLAELEEGKRGGDQQLSAAQTALALHEEAQQR
GDRETKALVEKVATLERSLQASEGDNRTLQEKLARAQAAESRLEGERRRLKEAVEASEAR
GSRLEISQRTLEGELQRAQMAASEREAEVATLQERLAGLRQELAESEDRGAALRVNSERL
SVALARAEEGEGQLKDKVQSLSRALSDSSTSAGALQERVAELQKALTSSEQDRRVLQERL
DSARESLSECKRQNHVLTERVQSLQRAQEETALRSRDLESQARSLQETLRQKQGSEQEAL
DGSRQLREERQSLQERVNALQHAVEHLESKRNELERAVARLDKEKASLRRALDKVELEKL
KQEEETVRLGREKEQLDHTMSSMEQELADLQAEIEQLQAQISQLERAHAQRLLEVTGRHR
QEMELETERLRGAQQQAERALETRERAHRQRVKGLEEQVATLKEQLEQEMRRRQAYVNQM
LRPAV
Download sequence
Identical sequences W5ME21
XP_006637805.1.81211 ENSLOCP00000006630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]