SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000006842 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000006842
Domain Number 1 Region: 2086-2388
Classification Level Classification E-value
Superfamily BEACH domain 4.05e-123
Family BEACH domain 0.00000000872
Further Details:      
 
Domain Number 2 Region: 2505-2784
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.21e-29
Family WD40-repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 1986-2086
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-24
Family PreBEACH PH-like domain 0.0071
Further Details:      
 
Domain Number 4 Region: 598-761
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000369
Family Glycosyl hydrolases family 16 0.068
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000006842
Domain Number - Region: 241-361,397-547
Classification Level Classification E-value
Superfamily ARM repeat 0.000158
Family HspBP1 domain 0.073
Further Details:      
 
Domain Number - Region: 1116-1248,1284-1334
Classification Level Classification E-value
Superfamily ARM repeat 0.0023
Family PBS lyase HEAT-like repeat 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000006842   Gene: ENSLOCG00000005650   Transcript: ENSLOCT00000006850
Sequence length 2799
Comment pep:known_by_projection chromosome:LepOcu1:LG11:16307430:16369059:-1 gene:ENSLOCG00000005650 transcript:ENSLOCT00000006850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTQSLVYSKGLKHYTLKKDVGYLQQWLETFVMSFEKIIDVQTLEPRRQTERQCKDVLAP
VLEPSALSALVPTELWKEAISVNHSQGLSPHPLGSATFFPALVFRNMENIDPDRTPGFVF
ETIKLLSFCLAKLKEEPRDDEQLETVVLYGLLLLESLFDPYQTWRRQLAGEEVSLLERSK
YKFSPIALPEELPAFFHESLQDSERLPELPRLRLVHLQGAVISGSKKNGLAAIMPMAVSD
LMNVLSSWCYHGTPEPKDPRLLRLTLKCLTTMIHLLHASSLDQRQVDIRSVLDNYFRALN
WDRLPNSQEGEERCRWEDNLVTLRTHMLNAIPDMLNCADRPVLQAIFLNNNCFEHILRLI
QNSKLYQSSGCRPDCEGTYDLTTRLLTELDVEQVWEKGSDSITVHALGVLTAIMSNSPSA
KEVFKERIGYSHLFDVLKSQGQPTKRLLQELMNMAVEGDYSQAVTLGISNDQPLLLLLQW
IPDLASRNLQLLVSQWLAGVCGGSLPCRTTAVEAGMVWALLEVLAQLEHLDRQCAEALLG
LLQSLGSLSLRPNEFKSLLRLLRVDQANSGAVHPYCGHVVRALSAMAAREGRDSALQYFD
LTPSMAGIMVPTIQRWPGSGFAFHAWLCLNAESHDLTPTTPTSPSTPTQRLGKGPRRKQL
YSFFTASGTGFEAFFTSEGMLVVAVCTKKDYMAVTLSDCPLTDCAWHSVDVVHIPGRRPF
GQNLVSIYVDGCLRKTAQLRFPSLNEPFTSCCIGSAGHRTTTTTSPTTPLPPHSPAEPAF
PPNIPPLTRSQSFPASFATMQWGGPAPPASRDAQVHSIPAGLQDTEWGSPTSLEGLLGTA
FICHEALQAAQARALYAAGPNSVSLFKPDGELSDLNSKLLLYYTPKAFKNQICLDLSPAH
QYDGRLTGHRVVNWDVKDVVNSVGGMGVLLPLLEQVCALGEAGREEQETSDLLGPELTSS
RGPAGMLLPLGKSSEGRLERNNVAAFLLMVKNFVCHHPVNQDSLLQCHGPAIIAAMLTKV
PSSLMDMSVLMASQILLKQVSSEGNSALLTSLYQHLLFDFRIWSSSHFAVRIGHVQYLSS
VISEGRQRFRRKYGVQYTLDSIRTHYGISQETQYHGSQHGRLPNSVFILTQQKSEHLRQE
LFSSCAAYAACIYRAEQLLVISVLDMLYSLLRSSPPRDQLLAVLLDSGVEPLYCLLLNGA
FGDGVRERVFRILYKMLKYERVSERGKHRLKLRDCGYLGLVCSLGDIPVTLTTIRCLYEQ
VLATDSTPNFRDLLAVAYLSHRADLAVRLDVCRKLFHLIYSSEDNVKQLARQPGWQDVLT
KLYVKESYESRAASQSGLSPASSLETAQPSLLRQDSMVLEEPAHEVFLPYELRVEEEEEE
DPPDVSVSEGFSDLSLSPVGGSQLKNFGNSLNFKSFDSAELASQSSSISNTVDIPGHRAD
EEQGLYHPLSPFSGSPFDLGLELGGGAGGGGTGSQTPVSQADTPSPLDNCKPFPGLRARK
SSSLSNILDDGSYGTEVPPGDNTSNTSNPQQTPEEELCNLLTNIVFSVMWSGAEGSEDAV
WRERGQVFSVLTKLGSSCQLVRPPDDIKRSLLEMMLESSLTDLRDSVGTSPTGHCLSIVR
LLRLLQDFLFAEGTDNQALWSEKIFEGVVNLMDRLQAWYGSPGPPELREMAQIGLRIITG
YIQQQHSQVFAMACVKLHSLLQTVLCLVWEEVCFLLGRLGAPLLQALEEGGRAEAFSQLV
PIMRTLLDQHADPSALHALLPSLPPTNGSATFTQDLQQYICTQEWKDFSTHHVQPTMQQY
ELDTFGKSHDLMSNFWNSCYDALMSTAQRRDKDRAHSKARFQEVIVEPCLRRVRSENTRY
YSALKQAASQQAAVLRQWKALRRQLTSERGAWALRIQPEVHWKLSSAETYSKMRLKLVPT
YNFDSHREASALRDNMGTDNRSLAEPLPLAVAKEAKVSDMEDDQLGDEDLVYLDNQTEVD
EENQKEKLVLSEECELITIVAVIQGRLEVTTHHLYFYDGTSEKEETEEGIGYDFKRPLSQ
LREVHLRRYNLRRSALELFFNDQAHYFINFKKKVRNKVYSRILGLRPPNLFYFGSRSPQD
LLKASGLTQKWVFREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLCDYTSETLDLDDPA
VFRDLSKPIGVVNPRHAQEVREKYESFEDSTGTIDKFHYGTHYSNAAGVMHYMIRTEPFT
TLHIQLQSGRFDCADRQFHSVAAAWQARMESPADVKELIPEFFYFPEFLENMNRFDLGCL
QMSQDKVSDVVLPRWAESREDFIRKHRKALESEHVSAHLHEWIDLIFGYKQRGPEAVEAL
NVFYYCTYEGAVDLDAIANETERKALEGIISNFGQTPCQLLKEPHPPRMSAQSASRRQAR
LDTLPPNLFEHLGKLKAFVEVVSDGVPLVQAVVPRNHTRSFITQGCDLLVVTVSASGLLG
IHSWLPYDKNIANYFTFTKDPTVSNPKTQRILAGPFSPGVQLGSRVLVVSNDARLLFSGG
HWDCSLRVTALTKGKLVGRICRHIDVVTCLALDLCGIYLISGSRDTSCIVWQVLQQGGFS
SGLAPRPVQVLSGHDQEVTCVAISTELDMAVSGSKDGTVIVHTVRRGQLLRTLRPPCESC
SAASVTELAVSMEGHIVTQTVIEGRSPHKDKYTLHLYSINGKQLASVTLEEQVTALYLVP
DFAILGTAEGNLHIRELYSLQLAVSPLALKLPVRSISVTKECSHILAGLEDGKLIVVGAG
QPAEVRSGQFSRRLWGSTRRISQVSSGETEYNPQEAAGK
Download sequence
Identical sequences W5MEN3
ENSLOCP00000006842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]