SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000007652 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000007652
Domain Number 1 Region: 231-323
Classification Level Classification E-value
Superfamily TAFH domain-like 1.22e-32
Family TAFH domain-like 0.0000156
Further Details:      
 
Domain Number 2 Region: 634-682
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000176
Family TBP-associated factors, TAFs 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000007652   Gene: ENSLOCG00000006335   Transcript: ENSLOCT00000007661
Sequence length 847
Comment pep:known_by_projection chromosome:LepOcu1:LG9:12567719:12634528:-1 gene:ENSLOCG00000006335 transcript:ENSLOCT00000007661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAASAPAEAEPVTMNSAPAQKSAIAPGQVTLNIINPSAAVQAPLSSTASKMALXPGLQAV
TSGAPAPRPGLPAVTSGTPASKTTTVQLPANFQIPQGMVLIRSDGGQLMLVSQQALAQAQ
AQGLGLPRTAASTSSTTARAPATQTTVTAIIRKPETTSVAKAQPQHSGAAVTSLQRIPLV
KSTGGTAAAVTSVQAIRPTAPTPPAPPAVPATTPFTAELSKPTPAAQSTFSAETLENVKK
CKNFLVTLIKLSSSGARSAEMAQNVKELVKDLLDGKIEPEEFTERLYTELKSSPQGYLVP
FLKRSVPALRQLTPSSQLFIQQCEQQKPEAASVTPPAAAVKPAPATPAKPAPLEQGTLVV
WESVQFPRIKGLVSMYACYTIYSNNCSSSGTHPSMLYQVCQQLLPWGPVLDSVDVHAFCD
LDRKGQNTADIIRQSQQPYVGTLMMYSCKIVETSLALIWSSLKTSILEWGTASRSSSSLK
RDIMVLQQTRGVVIKQPFATVQPQSAALLQTRVLQKPPLTAAFQTSLQQTGNINGLKDSS
QTLGRSGVEAASSFKGTVVKQALFHKPNIINVQTSLVQKTSFKENSSATFRDEDDINDVA
SMAGVNLSEENARILATNSELVGSIIRSCRDEPFLLTAILQKRILETGKKYGISDVTLDV
VSLVSHAAQEHLRELIEKLTVIAHHRKITYKDDGYVQQSDTRSQLKFLGQLDRLEKQKRD
EEEREVLLRAARSRSNKEDPEQLRLKQKAKEMQQLELAQMQQRDANLTALAAIGPRKKRP
LDSQVNGSGSEGLRLSLFLKGSSGLSAVPKSWLLQRTTRASLRDLLFCMEQQPSLRHSLA
LYRALLK
Download sequence
Identical sequences W5MGZ3
ENSLOCP00000007652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]