SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000008063 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000008063
Domain Number 1 Region: 431-824
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-135
Family Ankyrin repeat 0.000000000161
Further Details:      
 
Domain Number 2 Region: 192-449
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.38e-73
Family Ankyrin repeat 0.00000323
Further Details:      
 
Domain Number 3 Region: 35-259
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-55
Family Ankyrin repeat 0.0000156
Further Details:      
 
Domain Number 4 Region: 1497-1606
Classification Level Classification E-value
Superfamily DEATH domain 1.83e-25
Family DEATH domain, DD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000008063   Gene: ENSLOCG00000006646   Transcript: ENSLOCT00000008073
Sequence length 2099
Comment pep:known_by_projection chromosome:LepOcu1:LG5:10087560:10290963:-1 gene:ENSLOCG00000006646 transcript:ENSLOCT00000008073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTPIGGGESDTAQGGSSSLTTPEDKSDSNASYLRAARAGNLEKALDYLKAGVDINICN
QNGLNALHLASKEGHVEVVAELIKLGANVDAATKKGNTALHIASLAGQTEVVKELVTNGA
NVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSL
LLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKMMVNRTTESGFTPLHIAA
HYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNGNMVKLLLERGARIDAKTKDGLT
PLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDV
TNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIASKKNRIKVMELLLKHG
ASIQAVTESGLTPIHVAAFMGHENIVTQLTHHGASPNTTNVRGETALHMAARAGQAEVVK
YLVQNGAQVEAKAKDDQTPLHIASRLGKADIVQQLLQHGASPDASTTSGYTPLHLAAREG
HEDVASVLLEQGASLSTTTKKGFTPLHVAAKYGKIEVANLLLQKKATPDAAGKSGLTPLH
VAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADTNAITRQ
GISPVHLAAQEGNVDVVSLLLARNANVNLGNKSGLTPLHLAAQEDRVNVAEVLVNQGATV
DPQTKMGYTPLHVACHYGNVKMVNFLLQHQAKVNAKTKNGYTPLHQAAQQGHTHIINILL
QHGASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETLTTTTVTEKHKMNVPETMNEV
LDMSDDEGEDAMTGDTDKYLGPQDLKELGDDSLPQEGYMGFSIGARSASLRSFSSDRSNT
LNRSSFARDSIMIEEMLAPTKDTHLTVTREYDSDSLRRYSWAADTLDNVNLVSSPIHSGF
SSPLPQYDSRFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLASP
PPMVEGEGPASRLVEVGPAGAQFLGKLHLPSSPPPLNEGESMVSRILQLGPRGTKFIGPV
IVEIPHFGSMRGKERELIILRSENGETWKEHQYDCKSEDLNEILNGMDEELDSAEDLEKK
RICRIITKDFPQYFAVVSRIKQESNQMGPEGGVLSSMTVPLVQASFPEGALTKRIRVGLQ
AQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVTNGYKGDTTP
SLRLLCSITGGTSPAQWEDITGTTPLTFVSDCVSFTTNVSARFWLADCHQIPETVGLASQ
LYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVL
EGKPIYVDCYGNLVSLTKAGQQLIFNFYAFKENRLPFCVKVRDNSQEPCGRLSFLKEPKT
TKGLPQTAVCNLNITLPAHKKELESDQDEETEKPERRHTFASLALRKRYSYLAEPAMSPQ
SPCDRTDLRMAIVADHLGLSWTELAREMNFSVDEINQIRVENPNSLTTQSFMLLKKWVSR
DGKNATTDALTAVLTKINRMDIVTLLEGPIFDYGNISGTRSFADDSAVFLDQADGYNNIQ
MELQTPTELRYEPPTPLRNDDFFSDVPSVDSPFRNPCRPSNLSLSQQLQSSSAATKPPKV
TAEDTSLDDHRLERWTVPGESRDETQACEQEEETDTSPESVTPPAQEDKGVVKEQGVFLE
RLQQEDDRPEGSWQPGARASVPYHGVTAEEEGSQSGSEEEEEMMQEQLEDIWSEGKEMPE
ESVQANLKQVQQAETDMSPIPGWHSETSSVNVEPPTPGRSLSSDLLNRQENSQEQSSDSI
TSSSKEQPGKPKQNGEHVEFPSPTGTVPLAQEPASGAKGQALKEPGRQKAQKGPLRTEEH
TGPDPSLPPDNKPSMEGVGIAGSISSKRMSPDSPEDGRAGPSFQEEDSYTSEHKVQEHRD
SESSSDEERTVTTRVIRRRVILKGEQAKNIPGESVTEEQFTDEDGNIITRKVIRKVIRRV
VASEDKDREKGKKDENSKQPLSLEEECFKHSERQTVKEHGEGHKMKKKEVRHTEKKIHS
Download sequence
Identical sequences W5MI54
ENSLOCP00000008063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]