SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000010349 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000010349
Domain Number 1 Region: 625-1044
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 7.45e-97
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000449
Further Details:      
 
Domain Number 2 Region: 290-622
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.57e-72
Family Lipovitellin-phosvitin complex, superhelical domain 0.00000027
Further Details:      
 
Domain Number 3 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.02e-69
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000048
Further Details:      
 
Domain Number 4 Region: 1205-1378
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.63e-33
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000010349   Gene: ENSLOCG00000008476   Transcript: ENSLOCT00000010362
Sequence length 1676
Comment pep:known_by_projection chromosome:LepOcu1:LG10:16875738:16909276:1 gene:ENSLOCG00000008476 transcript:ENSLOCT00000010362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGLLLIVSLALVVLYYFNFQPGLNSRKTYEYNYEGTVRIGHVEKNMVESGLKISCSVEI
SGIADHTFLLKVINLSVEELNGIPGKSGFYSSPKLTDRISSQLTQPIKFEYIRGQIKDIY
AAPNVSETVVNIVRGILNFLQVTVKNTHAVYQLEELGIHGFCHTSYVIEKDKKSKEIYIT
RSTDLRNCQEKAEKYIGLANAPKCKNCKEKGSQAEETVTYTYTMKLTDEGALITEANVQE
MHQFTPFNVKEGTSLLEATKTFVLVNVKDAQGKPPKILLQNKGNLKYKFGSELNQIPLVL
MKMENPEFKIAELIQRLVQANTQQIDANSTTDILKLYQVLRGSTIANLEAVWKKSSDDTN
KRRWLLDSMTAISDTKIITFVKNRIRNKEITPNEAGQALLVILNKITPDSEAVEQSREFL
ETTFNKNHSVLWRITMLAYGSLIYRYCVNSEHCPGNALQPLHDLALDALSNGNEEDMILN
LKALGNAGQYASMKIIMKFLPGFASGASQLPTRVQSNAVLALRKIAIKDPKSVQDIVTKI
FLDKNIHAEVRMFACLVIFEAKPSMALVSTITGYLLKESNLQVASFCYSQIEALARSVTP
DNQELSIACSAAVKILRPKLAHLSYRYSKAFHFDWFHDPTLSGIAADLYMINNAASSLPT
AVVYRFKSYFIQRVIQPLEIGLRAKGIQELFNKNPLPINGRPGRIEKILQMLSGWKAIPK
ETPLVSGYVKFFGQEVFFADINRNMLYNSMQTLSTMAGKQNNTLKIIEDLQNGMALHWTK
PYLIFETRYIQSTSLGLPAEISKYYSSMMGVFINAKAKFDPVPSNHLGQLMNSNIDLQAD
GSISIIKDFSCFHGINTDIVQAALQFDGKANVVLPFKVKIKMNIKEGKFQIDMPPCQREN
EIMSVSSQVFAISRNREDSASKKTPVVVVPDTRESEKHNASSNEASRKPKKKLVCFYLCF
SKEEITSTNLQLKSGDKMYREEAHLCVKANTFGMEVCLETKARNAFFLNRCPFYYLLGEN
YIKLKLKPVPTDGTIQKISIKMNVGSDQESQRLNQMMIDALNSLKKQSSNSTRSISSSSS
SSGSSESYQKGQYAHKSRQWHRKNPSVSSSSSSSTWEPRHGRKRPHWSKSRVLRTDRNST
GSSSSSSQESSNQYHSLYNYRKGLILMYMMMMIYSSYPGLRRSGMADQYKIASLLQSRVF
GKSSQPTVTFQAVVVRSNAKQEGYVATACISHTTTKDKMKLLISDVNKESKWKMSTDAVM
DMDPLRTKVQVRWGEDHWKYKFAGEARYVEKCGSYPSVKAKLQWEKVPRFMKTFGEKVHE
YLPGIALLLQCYQKQQRNPSHQVSVTLMPTSSSAMFDVILKTPGLTVYGYTIPLPFEIPT
HRRSKEEIDLKPSGCTDVDEILIIRINLNECSVTGNNFKTFNNIKFTSLLPKACYHVLAQ
DCTDDLRFLVLMKQETPNKKEVNIRTPFGSLNIYHTGAGDLVLTLNDSPMLLSTLPLKDS
SGTLLISKHGDGILVQAPTLGLGSLYFSGESVKVEIESWMRGKMCGMCGKADGEKKTEFR
MPSWNTAMNPSSFVHSWILQGEVCSDVSVCKLQHQTVKLEKHVSLMGRESNCYTVEPVLR
CRPGCSASDTVHISVRFHCVPLDHNLSQTEIVTKSEQMEGMTEAHIACICSGTECS
Download sequence
Identical sequences W5MPP0
ENSLOCP00000010349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]