SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012351 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012351
Domain Number 1 Region: 623-1050
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.53e-113
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000016
Further Details:      
 
Domain Number 2 Region: 17-285
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.61e-81
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000962
Further Details:      
 
Domain Number 3 Region: 285-621
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.44e-77
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000155
Further Details:      
 
Domain Number 4 Region: 1279-1449
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.55e-52
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012351   Gene: ENSLOCG00000010091   Transcript: ENSLOCT00000012372
Sequence length 1644
Comment pep:novel chromosome:LepOcu1:LG10:25383116:25413146:1 gene:ENSLOCG00000010091 transcript:ENSLOCT00000012372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLTIVGSQQITFEPTFSGSKSYQYKYEGILLSGLPEKGLARAGVKISCRVDISEVAQKT
YLLQLLQPVIQEYNGIWPKAPFHPASKLTQALQRQLTQPIKFEYRNGHVGHIFAPAEVSD
TVVNLHRGILNMLQMTLKATQNVYELQESDISGTCQTSYVIQQDRDSDQIIVTKSKDLDN
CEEKVQKNMGMAYIHQCPTCTKFGRNLRGTAASTYVLKPMRASPSGFLVTQVTSQAVYQF
TPFSEINGAALTEASQKLILEETRGARANFLEQQFQNRGRLQYQFASEILQSPIQLFRTQ
SPEIKIKEVIQYLIQNNEENVPMNAPSKFLELIQLLRACSKGNIEAIWRQYENTKQYRGR
RWFLDALPAVGSPTVFKFIAERILKRDVSTTEAGQMLVTAMHLVRASHETMEMAMELLNS
LENLKWQPVYKLAVLAYGSMVNKYCGRPEDCPATVLKPLHDMAADSMSRAHEEDIVLALK
AIGNAGQPASIKTIMKFLPAFSSIANHLPVKVQADAVMAMRNIARKQPSKVQEITLEIFM
DRRLQPEVRMIASIVLLEAKPPLALVVTVAEALLKETSLQVASFVYSHIKGLSRSSAPEH
HALSAACNVAVKLLSSKLDRLNYRYSKAIRMDMYHYNLKAGAAMNMFLMNSAASVFPTAF
ITKLQASVLGSSSDPLELGIRAEGLEEALEKYEDEFTNMPTSKKIEKVLKMLSRWKSVPS
EKTLASAYIKLFGQEISFSRMNKKYIEEIMQAIREPVERQTLIWRIVTQLQSGTAVQQSI
PLLVAEMRHIIPSCVGLPIEMSLYSAGVATASINAQMQITPTLAREFSVTQLLNSELQLK
TDATTSFTMNAVAVMGVNTHLIQTGVELQARVHTVIPMKFTAKLDMKEKNFKMQFEPCQT
ETELLMMRAQAFAVTRNVEDLEAAKKTPLLPESAQAEIMKQHFDPEASAPRRRDSAEAMT
RLSDEMISPGSVTSDEQRRKHSSHRMYNVCTKIRNFGFQLCFEAKSENAAFLRNTPLYVM
IGQHFYKIDLRPAHSSDATVEKIEVEIQTGPKSASKIVRMVAIDEYPRAKKLAGSVLTKL
KGILKPFKGHHHNATGISWRSGHHHNATGISWRSSSSASSSHYHPQSRRTSQKNRHRKKD
HNRHPRVGGHFRRHGTNTSMSSSSSSGSSSEMVRGEAYVSMIKSLNFRVFISLKEIDYSQ
TWRNCRKTTVSLRSIRSKTMYRGRADNFNLRFKAHGHLLQGDPGNARPFTSSSSSSSSSS
SESSLASKPEFKFLGDSTSPLFAVVARARRSDGLQQGYQLAVYADTTLSKPRVQALAIEI
NSKDKWQVCADAELHNDYKALALVRWGQECREYKVAVKAATGRIATHPALQVKAKWWKIP
RAMKYAGETMAEYVPGAALMLGFSQKWHKHTSKQLALYIAMSSPRTVDLFIKTPRMALCK
QAVPVPVAMPYGPIDEMQKPLGLLHSLSEVPIMLAESTKSQCSVHGSKVVTFNDVRFSYD
MPRSCYHILAQDCRSRPKFIVQIKRATVSQSLYVVRAQIHNNDIEMLPSTSGALRLIFND
NKIPSSNLPFSDPEGMIHIDKEGQGLVLKAEKYGLEKLYFDGRKTQVKVGYTMKGKTCGM
CGHNDGETKKEFRMPDGRVTKSAS
Download sequence
Identical sequences W5MVE2
ENSLOCP00000012351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]