SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000012416 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000012416
Domain Number 1 Region: 625-1049
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.26e-123
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000943
Further Details:      
 
Domain Number 2 Region: 289-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.14e-89
Family Lipovitellin-phosvitin complex, superhelical domain 0.0000000278
Further Details:      
 
Domain Number 3 Region: 23-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.1e-83
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000152
Further Details:      
 
Domain Number 4 Region: 1305-1475
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-61
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000012416   Gene: ENSLOCG00000010104   Transcript: ENSLOCT00000012437
Sequence length 1781
Comment pep:known_by_projection chromosome:LepOcu1:LG10:25419385:25443534:1 gene:ENSLOCG00000010104 transcript:ENSLOCT00000012437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLIVLTLTLALVASQQVNIEPDFSASRTYVYKYEGVMLAGLPTAGLARAGLKINSKVVI
SGIAQKTYLIKLLEPQLSEYNGIWPKDQFVSASRLTQALAPQLTTPIKFEYDSGRVGRIY
APSEVSETVLNIFKGILNMLHLNIKKSQNVYELQEDGVQGVCKTEYIIREDQKRGRISVT
KSKDLSDCNDKIVKDIGMEEIEHCAHCQQRGKSLRGAAAYSYILKPTDSDALIIEVTAQE
LHQFTPFNEMTGAAQLEARQNLIFQEIRNSPVQPGESEYQKRGTLRYEFSSEILQMPIQL
FRNRNPETQIVEILGHLVQNNQQQVHEDAPLKFMNLVQMLRIASYQNIQAIWKQFKGKQD
YRRWVLDSVPATGTSSALRFIKELIQNDQLTLMEATQALLTALYQSYVNHDNLNIAAELV
HNRHVQQEPILRKVCLLGYGSLVHSYCQKHDSCPDSLLEPLHNFAAEAASRGHQEEIVLA
LKAIGNAGQPSSIKRITKFLPGFSSGASHLPVKIQVDAVMALRNIAKQDRKKVQEVALQL
FMNRELHPEVRMVACIVLFETKPTMALVTTLADALLKETSLQVASFTYSHMKALARSSSP
DYGPVASACNVAVKLLNRKLDRMSYRYSKAIHMDIFKTELMAGAAANVFIINDAVSILPR
ALISKIRGYFSGAAADLAEFGIRAEGIQEALLKRQAATDSEEIDKKQRILKALTDWRSFP
SNKPLASVYMKFLGQEITFGTLDKNTIEDAMQAATGPLDQHDMVKKVVKLLRDGVTFQWS
KPLMVAEMRRIVPTCIGLPMELGLYSAAVAASAANIQTRLTPPASDNFRITQLMNTNIQM
QAEITPSIAMHTIAVMGVNTHLIQAGLEIYDRIRTEVPLRFAAKLDIKESNFKIEALPVQ
QQERLFSMRAESFAVTRNVENLPSAKRTPIVPESNQAKLSEEKFSSQQQTYTERSRGMAR
TASEMISSQTPYYSEQRPHPISSTVHKTLCFTSPTFGFQACYEEKSQNAAFIRNSPLYKV
IGKHMIYIDLKPVHTEEPIEKLHMEIQAGPKAASKIIKMVSLKDMTIDKEEEAAQGKTVL
LKLKKILHTVFFYACSKYKRVHSYNRALGCQRYEVSQAHKTRSLRRPLLSSQRNATQGDS
SSSSSSSERSNSSSSSSSSRFRAGTENLRIRTRKSSSSSSSSSSSSSSSSSSSQRRSPRT
HSQNQNQNKNLRRNFHSQKQNRMNGDYWSIRSSLGSGQIMNPAMYKFKKHHIHQASFLFL
FSMHAQTSAPLHCLAHFTLQAQSSRSIASFETANKKPRFLGDSMPPVLAILARAVRTDGK
AQGYQVAFYHHPRSSQPRAQVIVAAIQEKDNWKMCGDGMMLSQHKAMAKMSWGEDCQQYL
AVVKAETGRLAHNPAVQLKIKWRKIAGIVKHVSKILFDYVPGVSYMAGFSEDRRNNPSKQ
IKMIFAATSSRTIDAVIKMPRFTVYKRAVHVPLALPVGPDILEEVKEEGWNMLSRLPAMF
TEANTAECSGVNETVMTFNDVKYNNEMPISCYQVLAQDCTPELKFIVMLKKDERSEQNSI
NLKLADVDIDMYQGECSVQLAIDGVEIPLATLPYVHKSGKITINMKEDGLALTAPSYGLH
EVFFEKDNWKKIKIQVVDWMKGHTCGICGRSDGETMQEYSTPNSRISENALSFAHSWVLP
AANCGNDYKCTIKHESVKLEKQVVLEGQESKCYSVEPVLRCLHGCLPIRTTPVTVDFHCL
PIDSHVSRSSGQSSIWEKSVDLSESVDAHIACRCSEQPCTV
Download sequence
Identical sequences W5MVK7
ENSLOCP00000012416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]