SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000016139 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000016139
Domain Number 1 Region: 423-811
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-130
Family Ankyrin repeat 0.000000000276
Further Details:      
 
Domain Number 2 Region: 186-441
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.42e-75
Family Ankyrin repeat 0.00000289
Further Details:      
 
Domain Number 3 Region: 34-265
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-62
Family Ankyrin repeat 0.0000182
Further Details:      
 
Domain Number 4 Region: 3232-3340
Classification Level Classification E-value
Superfamily DEATH domain 2.33e-26
Family DEATH domain, DD 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000016139   Gene: ENSLOCG00000013099   Transcript: ENSLOCT00000016170
Sequence length 3648
Comment pep:known_by_projection chromosome:LepOcu1:LG4:63369329:63497657:1 gene:ENSLOCG00000013099 transcript:ENSLOCT00000016170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEETAPRGDAAEKQNGIGQRRKRPKKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCN
QNGLNALHLAAKEGHVDLVQELLGRGSAVDSATKKGNTALHIASLAGQGEVVKILVKHGA
DVNTQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSL
LLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVA
TLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGAQIDAKTRDGLTPLHCAARS
GHDPAVELLLERGAPMLARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDYLTAL
HVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITE
SGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAL
VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL
LEAGASHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQ
KVALLLLDKGASPHATAKNGYTPLHIAAKKNQMDIASTLLQYGAETNIVTKQGVTPLHLA
SQEGHTEMVTLLLKKGTNVNVPTKSGLTSLHLAAQEDKVNVAEILAKHDANLDAQTKLGY
TPLIVACHYGSIKMVNFLLQHNANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNA
TTVNGNTALAIARRLGYISVVDTLKVVTEEVITTTTTVTEKHKLNVPETMTEVLDVSDEE
GDDTMTGDGGEYLRAEDLKELGDDSLPGQYLDGMNYLRFSLGGRSDSSDRSHTPIHGSYM
KDGQIEDMITATSHQISALARETEPYRISWGNEHLDNVAVSASPIHSGRSSPCLDHDNSS
FLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLA
SRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAAL
RGKERELVVLRSETGESWKEHSCEHTEEELNEILNGMDEELDPPEELEKKRICRIITRDF
PQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMNVELVR
KILGNKATFSPIVTLEPRRRKFHKPITMTIPIPKSSADGIMNGYSGDTPTLRLLCSITGG
TTPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLIDCRQIQESVNFATQVYREIICVPYM
AKFVIFAKSHDPIEARLRCFCMTDDKVDKTLENQENFVEVARSRDVEVLEGKPIYADCFG
NLVPLTKSGQHHLFSFFAFKENRLALFIKVRDSTQEPCGRLSFMKEPRSYRSLVQNAICN
LNITLPAYSKESDSDQEQEEETSRTHEKYEEETDSTETSALKMHLIRDSPVLASPDLLSE
VSEMKQDLIKMTAILTTDSTEKSSPVEGGGLEKGTDDEPGEPFEIVEKVKEDLEKVSEIL
RRGTYTGKTASQKKEAISQAARQEEEWVLLTDSEIEEAKQMAPFEVQEPLIQEVKIDRGT
SRPKTAKDVSGMVSYLAEDLNEFLLQQPAKIHTPPEGVIEEHFKEVRVQRGSKYMSLEQD
TKLPPSDIKKPVRRKLKEKNDQKESQIATSESDIYRVSSEESLDESMILSSAPKEVSPVV
EETPIGSIKEKVKALQKKVEEEEKGRKQISSKALSSDESKLSQIKKETKMPHSPPGMSST
TERLEETMSVRELMRAFQTGQDPSKRKSGLFEHKSTNLITEHSTATKGTETVKTHSIQSK
TGYVTKNHEQTTSLSLDSSEIQDSETSKENEYSIMKEEISPKLSTSIPDMLLQVEKCEAK
VIDEFHKETDMQISPDRKHSMDFSEEIKAELEGSDEYKQFRKISCHDESEPSTKHEDSGA
VQHDLTIVFPPELSKDEFLPDTVLQNGALDDSSESLKHEGVADSPSISLGDGTPQMSSEE
SYKHEGLAETPETSPESLSFSPKKIDQQMLERSKESGKEKSESLANDSTAADSGVTTFDE
QQSTEMTLPTSPTEETDDQTMSESTGLKGDTVFCGEDTNEKKGVSSSPKPSQFGLHSKRV
SETVDTLLSSEDDVAPEIASQEVPKSSGLPTEKSATYCHDGLDLPLKKQDSEALSPLADD
SLTISHKDSLEASPVLEDNSSHKTPDSIEPSPTKESPCRDSLESSPVEQKIGAGIPVVEQ
ASGPASQTFPTKADFPAEAVRNRLLRDPEGSADDDSLEQTSQIESSGKSPLSPDTPSSEE
ISYEVTPKTPDLQVLSVPSKPPAIPEDTEEADEDDSSDSSEPQKKFTPEEEMFKMAAKIK
TFDEMEQDAKCKREVRRDFKTTDASAVSEFLEGQPIRIVSPDESSSESEPELTNLEKDLD
SALSVEPIIKVQPPSPLPPGMCDDCSPVEPEEHHAYSYVEAEEERTVPPSEHEQQTEQTI
LTHSCEPSDGSFGATECSLVSISHEGSIKKETSDHPQVPASIELYEETKEAEQETSPYDN
VSFHMISISTDSEESKKRTTDEKEECFEQLSESKEDNRGTGTVTECPSKLSFGDSPTETN
AKEEIKGEHFEWSSRSDICDDSHDEFDPIMERAQDPCKPDVCVYDDIQVEDAPASGLKTQ
SKGVTARPESDVDTWSAIREDDDAFAARVKEEEQKILSLMVDRQSQGATPDTTPGRTPTD
EGTPTSEQNPFLFQEGKLFEMTRSGAIDMSKRSFEDESFHFFQIGEQPFEEILSDEARED
PVGCESSEGESAVSITVSSLDIKTENDLHDTTNDEIDLFLPQSEANDDDQSPCTGTMVTK
SESKSRIPIKMGISASTKTVKKDPPCPELTDGKPEKRDEESPDTETSITDVQLNFSTVTR
SVYSEQDEESSDSSPEDQHSVIEMSKSDTETVTTSEPKSKLPVKESSLSASSAVTSTQKE
PPLEEDTKSKSKIPVKLGAIKPESTSDVSLKRGESLKDPDRKCKIPVKQEQRSKSETDAC
PSGDGKSKRSSKVRSYCEGESQETSQDTQSRTESDDVVKPRTFQSRLPVKTKYGQTFHTS
TPAKENKEQFFELYKHSIEFFEEISDEASKLVERLTQAENEQEMISDDESSTLEVSVIES
EACFESQLPLPEDVFDMRPIWDESVETQMQLIPDENVHAQCEDPQDDAERKEERLAVIAD
HLGFSWTELARELDFSEDQIHQIRIENPNSLLDQSHALLKYWMERDGKHATESCLIQKLT
KINRMDIVHLIETKSMKSCQQLSSRTYAEIEQTISLDHSEGFSALHEDIDSPRTVRRAES
TPSKTQPSAGQQPPVVSEEDISVSFSSVHESTPKWDADTTVADLLRQAQKDKMQADMYRE
SELPFETLSLGPKQHCAVDQEAEVTTQLAFEKESTESTLANYMRDSGEQEIAEELGLLED
SSDEEEMVTTRVVRRRVIIQADEMPDIPPESVTEEQYTDEHGHIVVKKITRKIIRKFVSP
DGTEKEEVVVQGPQQDPVIAEEGDGYSKVLKRTVLKSESDQTEVTFSDPAAEGSSSGFQV
EPTHGRKVSKVIKTTVVQGERMEKHLGDPSLATGLPTAEDDFQQVNDA
Download sequence
Identical sequences W5N680
ENSLOCP00000016139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]