SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017274 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017274
Domain Number 1 Region: 5-558
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 8.37e-87
Family Acetyl-CoA synthetase-like 0.0000152
Further Details:      
 
Domain Number 2 Region: 721-1069
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.63e-42
Family Quinoprotein alcohol dehydrogenase-like 0.0052
Further Details:      
 
Domain Number 3 Region: 543-594
Classification Level Classification E-value
Superfamily ACP-like 0.0000471
Family Peptidyl carrier domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017274   Gene: ENSLOCG00000014012   Transcript: ENSLOCT00000017305
Sequence length 1071
Comment pep:known_by_projection chromosome:LepOcu1:LG4:72088483:72102198:1 gene:ENSLOCG00000014012 transcript:ENSLOCT00000017305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGATLHELVRAAGCAHGHRVAVRFEDGTGAACVSRTYAELLASADELSTLLKRCRHLRN
ERVFGLYYQPGVHLASWILGILQVPAAYLPVDPEAPSQLSAGVLRQSGLEYILVQSDLIQ
RFQNSFSTYLRLEVSEELPSLSVLLVELRGRAPSSPLAGAGWGERAAAQADSGAPGSLAY
ILHTSGTTGPPKTVRVPHSCIVPNILHLRSLFQMTPKDVVFVASPLTFDPSVVELFLALS
TGASLLIVPSVVKMIPSKLAEILFKRHHVSVMQATPTLIKMFGTSLLQTTVLSAATSLRV
LALGGEAFPCLSVLRSWKEEGNQTQVFNLYGITEVSCWATCYQIPEGAVGSSSADTDSVP
LGTPLLGTTVEVRDERGSVITHGEGQVFLGGGGRVCSLGDEAEAAAPGAMRGTGDWVELR
GGHMYYLGRRDRLLKRHGKRLSLEALQETIERLGLVQACAVTLHEGKRLLAFVVPAGQHT
DLESTILRSLSELLPLHSVPDQLLTVEALPLTLHGKVDLAELAKVYEQQRGLSVLPAALN
GRADLWERLQALWKGVLGLPEDAVVPSESMFLSSGGDSIRSLRLLEEIEAAVGRATPGLL
EVILSRPFSDLCRGVEAVAFPVKRGGGAPGRGKRRLAAEASPALAKPRRQEVAGERAPEP
AGFVVVRRAGQVLRRSPGESSEALRERTRDKSDASQDSGGAAAAPAGGSVESGAATGSPL
PQQEDAPLRLKVRWKSDTGKCVDASPALLACGEGGPVTAYVGSHSRRMQAIDMDSGARRW
ERVLGDRIESSAAVTRCGRLVVVGCYDGLVYVLRADSGETYWTFPTGSSVKSCPTVDLLT
GLVFIGSHDGHVYALNTEARCCAWSRHCGGGAVFSSPALHCSPRQLYVATLGSRLLALSP
DSGDTIWEHAGARPFFSSPCCSEEAVCLGSVDGSILCFSHAGAKLWQFSTSGPVFSSPCL
APAPPAGWRLLCGSHDGSVYCLSARGELLWRFRTTGKVFASPFVFGGGGGRGGPALVAVA
SADGRLWVLDAADGALRGSHSFPGEVFSSPVVWGRGLCVGCRNDFVYCLEF
Download sequence
Identical sequences W5N9G5
ENSLOCP00000017274 XP_006630184.2.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]