SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000017785 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000017785
Domain Number 1 Region: 646-824
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 81-282
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-40
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 294-363,427-461
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000542
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 500-599
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000104
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000017785   Gene: ENSLOCG00000014441   Transcript: ENSLOCT00000017817
Sequence length 852
Comment pep:novel chromosome:LepOcu1:LG2:63541700:63564327:1 gene:ENSLOCG00000014441 transcript:ENSLOCT00000017817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKETDSSSSESIFPPPSTKMDVYKEAADYLNAYGIEVQELEPDTLEDVFAMDSEEGFLPV
DTSPFSPQRSDSVDFPDTPTDWDPDRMLEMRLLVLRNILASEEQYLSELEALLMPMKALK
ATAFTSQPVLSNQQIQTVFYQVPELRNLHRDFYDSLKNRLELGDPQASVGDLFQKMVSQL
GVYCGFIDNYESALEVVRKCAQADERFRTLAENMMSSKGSDNSRANHTFEALLYKPLDRV
TKTTLVLHDLLKHTPSDHPDCPLLQESLRISSSFLSGVNEESQKKRAVTLSKGQNRQLVK
DAFLVDTSEGVRSLRHIFLYTDVLLCTKVKASWPGKSAQYRFGWYLPLVGLRLQWGREQE
LPADVQSRISTTRLKMFQLRQEIQLQAELMPKPEKGGRALGARTMDRSRRKLQECELWLL
THSPTTPLELNSPNGKSHTLLLSSLHELSEWRDAIEKLKAESFETVPPDLLTLTNSCVKL
RMVHHPPLLSLAPDSGDSSLCGTLSVAVHGASGLQEPASMYICLEVDGYMFFETKAQTRA
SLSSVAPQWDEEFSMQVDGARHLWVLCVQQPERGSSSTGDRIVGKSLVPLEPNVLQKKWK
KMTVTLNQLEVCLSLKFCAHSLEPPGLVPPPQQEVFKVLIGTVAEQEGALVPHIVRSCTE
EVERRGLEEVGIYRISGAASDLQALRTAFNTNLRDALSRLRAVDVNAVSGILKLYFRELP
EPLIPSDLFQSFAQALDMPDPKGRINHMLSLLDSCPDVNRNTFLFLLHHLKRVAEKQEIN
KMTLLNLATVFGPSLLRPPPMVLGQAGPQVDISQEVVVQVQVVFFYLQCENLPAAKTTHL
LDSEEIPDTVHS
Download sequence
Identical sequences W5NAX6
ENSLOCP00000017785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]