SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLOCP00000020643 from Lepisosteus oculatus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLOCP00000020643
Domain Number 1 Region: 1842-2107
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000785
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number 2 Region: 1676-1870
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000418
Family Tropomyosin 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSLOCP00000020643
Domain Number - Region: 275-429
Classification Level Classification E-value
Superfamily Tropomyosin 0.00255
Family Tropomyosin 0.0026
Further Details:      
 
Domain Number - Region: 15-191
Classification Level Classification E-value
Superfamily Tropomyosin 0.0053
Family Tropomyosin 0.0069
Further Details:      
 
Domain Number - Region: 381-609
Classification Level Classification E-value
Superfamily Tropomyosin 0.0477
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLOCP00000020643   Gene: ENSLOCG00000016707   Transcript: ENSLOCT00000020679
Sequence length 2817
Comment pep:known_by_projection chromosome:LepOcu1:LG1:44689528:44710837:1 gene:ENSLOCG00000016707 transcript:ENSLOCT00000020679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAVEEWKDGLPGKALQKIQEIESQLDKLKKERQQKQFQLETLEAALQKQKQKMEVEKN
EVTALKRENQSLVESCDNLEKTRQKVTHELQVKEQQVNYLEGQLAASKKQIEKLEQEIKR
NKVELDRSQQSVAAGDQQSYGTPQKSFATPATPSQKLHDSKLEEIQEKYYKEVEERQKLE
AELKVMQIKLLNQSSVSHKDIARQQTQSSIFPWQQDQTPSRQSHSFLETPLKRGIGASSF
LWDHEETPYKRNSRSTLHDNAGSSQQSEQLKAMNQDLKAKVSEMELCLQAQDKDMKNHVN
KLHEIQISFEKAKMELAEKDKNLNKCRDELTRVTGQYEQATSKCAALEQKLKQLSEELNC
QRHNADSSRLALEQKMKDHEKEYQKELVHQQNSLRSLDQEFHQMKSKMSQELQLAKSDYN
ALQAEMDKIVQQKHHLEKCVEDLKQKLCRTEQILQTSQTKENEMRKNFEGIQKEKNSLSC
QFEQSSRRMTQVEEELKAAKQNLKQSHSLMEDFKAKTLAQSEELKCLQVKMENQDQSSAL
ELENMKKVVSDLEKIKEMAQNQIKKQEQDLEQMKSKQTVMEKEQQALQIALDSKQNECTE
LKKENDFLSKWKTEKEDLVNSVEIEREHMLNKIGDLEKNIEMIQNVSCGLNEKVNSLKSE
KEDLTEQTDSLKGELLKKCMELEEKSKVYEELQKSSEEDNLKYTKDLENGNLQITELQAK
ASNLEMKLQLETCRADKMEQSYNEFILQYESACNLAKSKESVIDLKEEEILHLKNTISQA
LSQHEQQLEKLSTERCSLLKAHEESLYEKEQAFQQASLNFEKSQQEAALLKDQVSSLESS
LKLQKNLNVELQSKCEELSKVKVSLQEQCNLFSEAAKEKEASLQNLTKELESKVTQLQVF
KETGLKSSRLEDENAQLKARLQTLEEEIGQVTVRSRSLEDSHNILCQEKDSLLKEIYRLN
DLVGEKEDASAEMIQSYKNELGVANELCAQLKSSLEDLQGKYTSVMELNSTLEICLREES
YKKFSQDKELVELQKKYRDESEEHAAMLKGYEDKQMQLLQEKDALQSQLQNKSNEQVSTH
QSDLESLKSVLLISENCIVERNLKIEMLEAKLSAAELKQIEISDRLKEKEVQLNKINVQL
EMLQMDLEDNQKNCVCEGSEFEQLKNSLGILEGKLKENELQKSSLQKTLHSAREELAEKE
PVLEDAQKSSKSMNESYIALAAKVEMLQATNEKAQFSLDEEVKRYTVLENSYSNWVAEKT
ELKTKLTESQHQCLNALEEKLQEENQTLKSMLDRQNDKSKCSEELKMQNKDLESCQISSE
CQYDSLSNLSKQQCFIDQLQAEKALLTQETIHKKLKADTSELQTCVHDDGPLCRTHNDLC
PLESELLKKSEELKMLSQTYEDSLKTLKEQMDRQKEVSKEEIEELKAALSRVQHELDQLQ
QHHLDEVKVWQQKLVDLNAEMETRLAEEKQNCEFLSSELETARLQMQCLDLSSRSLLCSE
NDEEFHQVSLIEDKSNVMQSSFLHFPTSTIYLIRAGVCYKLIGTNNNGKMPMEKNTVFNI
SESERFMYLCLYISNQSLSTLFFTLKVLAVRPFVQFCIAIKYKVVLGLQANTEKGGIKCL
SPEKDPEELKTEILESTEQQYNPNVNEEVEHSVAGSNTAINDTFDGLLSGVEILTLENDS
SVVEDDLHTTKTSTENVQNDVQTLCSQLDLNKVEIISKTDLFAEMEEKFQKLEKENSNLI
QKLSVSVMENQKLDEHVRELDEELNSLNLQLKTSKLQLSDVTNLLESLEMAKGGWDEKLL
QIESDLKRTQSEKANLEKHILSLEAEFEEIQQKNEKLQKELDLSKKAIESLEQQLKGAVD
ERNQLHQDLSLCTEEKEEVERDFQRWKGKAEQLEKDNVDAKEFIKILEKDITNQKCQREL
ANSSLDNLQSEKDKLLQQLQNMEQTVVLLKEENQELLRVLNEVKEEKTSVSTECEVLESK
VQELGNENSKLSQLLESSLCEKGEIASKLNSTQEEVTQMRAGIEKLRVRIEADEKKKRHV
GEQLKASQRKADVLVDKIEKLEREREMTETSLEDAILQAESAKAELEILAPEKKELTKSI
ECKVQEINDLKAVKEKLEKELLCKNEQVVQLQISSSAASERLEVLEKEVKVAKTNQENAA
KTCESKVKEISNELQLSKENDLNSQLSCFKNENIMLSQKLQEAEKTLADVKSLNQVLSQD
CEAKQLKLIESTGVNDQLQQEVVDLQVLRQTAEEKLTSLKVEKEELEKEKVCLQTIVTEW
EQRSQIMSTKAEVMQNTINSLEDDLKQHKHNLESLQNEINDCLKKAERMQKDFELERNSL
SVELQSSRQEVESYKLSLEISASEKEDLKKNLALSQDNIALYEQKIKEMEGACQEKLALA
QERIKIETEMQHLMTFHVLQYEGEKQALKRELTGAEQKNIDCFTEINDLKSSKEELNLAL
KESEIKLEQCTKIKGDLNSTIMRLTKEKDSALNKLQLWMKSCKQLEQEKEALLKENQQQE
LLAKRNASLEEDFVSVSTIYNTAINNCSEILSINHYSINNILVAIHNERQFLDEELIKST
VGALQSEIQELKEALDEKSKEADESMEKYCNIMISLHKLEEANEILENKLALMSSQVLPL
KGSKTAGSTPKTSDSPTEKNPKSAERRRASPRGQSRLSAKRQRASGAEEETDPAKAQEHL
SSSKRVCGQVNPQTAQRTEEEDEEFRLEGLPEVVKKGFADIPSGEMSPYIIRRTTVQRCS
PRLAAKRSPTLQTAQKGLENAVPGQKPTAEGSKNKKQMEKRRQIVASENSSENCQVQ
Download sequence
Identical sequences W5NJ34
ENSLOCP00000020643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]