SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158424643|ref|YP_001525935.1| from Azorhizobium caulinodans ORS 571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158424643|ref|YP_001525935.1|
Domain Number 1 Region: 142-630
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.52e-111
Family Ornithine decarboxylase major domain 0.00000000437
Further Details:      
 
Domain Number 2 Region: 636-784
Classification Level Classification E-value
Superfamily Ornithine decarboxylase C-terminal domain 5.1e-40
Family Ornithine decarboxylase C-terminal domain 0.0000903
Further Details:      
 
Weak hits

Sequence:  gi|158424643|ref|YP_001525935.1|
Domain Number - Region: 30-98
Classification Level Classification E-value
Superfamily CheY-like 0.0288
Family CheY-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158424643|ref|YP_001525935.1|
Sequence length 785
Comment arginine/lysine/ornithine decarboxylases [Azorhizobium caulinodans ORS 571]
Sequence
MDYFRRFTFLFATPAFDADDLEGVRLNQIVDEIGRAGFEVVMARDLDDAQIAVQTDAAIG
CMLIDWGKKGLEGKTAALINLMRKRGLDFPIILLVRRKRFEDLPVEVLDFIDGYVFLSEE
TPAFIAKNLVSRLKQYAETLKTPFFGALVDYAEEGNQLWTCPGHNGGVFYSRSPIGRVFM
EHLGEAVFRDDLDNSVLDLGDLLTHEGPALQAQKEAAKIFGAEKTYFVLNGTSTSNKVAL
SALVTDGDLVLFDRNNHKAAHHGALLIGGGIPVYVPTVRNAWGLIGPMRWDKLDETALRE
AIRTNPLVSDPDAWQRPRPFRVAVVEQCTYDGTIHNAEMILKRIGHLCDYILFDEAWAGF
MKFHPLYAGRYAMGLSDLGPDSPGIIATQSTHKQLASFSQASQIHMKDRHITGQKRRVEH
RRFNESFMQHASTSPFYPLFASLDVGAQMMKGRSGEVLWDDTIRLGIELRKKIRASRREF
EEKESRPERRWFFEPFVPERVAIPDAARPGAFHDVPWESVGTDQLATDPAFWQLAPEAKW
HGFGDLAPGFAMTDPNKLTLLTPGFDRTTGDYTEHGIPAPVVAQYLRENRIVPEKNDLNS
LLFLLTPGVEASKAGTLISGLVAFKRLHDDNALLEDAIPEFFRRRPQRYAGVRLRDLCGE
MHRFFREANVSRLQAQQFCPEHLPEMAMSPHDAARCLVRNDVDYLPIDAISGRIATTPFV
VYPPGIATIVPGERLTERAQPMIDYLRMFEASFNTFPGFEVEIQGVYREIDATGRVRLYT
YVVSE
Download sequence
Identical sequences A8IE05
438753.AZC_3019 gi|158424643|ref|YP_001525935.1| WP_012171543.1.27236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]