SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189351760|ref|YP_001947388.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189351760|ref|YP_001947388.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.45e-33
Family Frataxin-like 0.0000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189351760|ref|YP_001947388.1|
Sequence length 108
Comment frataxin-like protein [Burkholderia multivorans ATCC 17616]
Sequence
MSDTEYLTRAEAVLAAVERTVDAANDGDHDIDLERNGSVLTLTFENGSKIIVNLQPPMKE
VWIAAKAGGFHYRYVDGAWRDTRTGTEFFAALSEYATQQAGLPITFTA
Download sequence
Identical sequences A0A1B4TTR0 A9ADN1 B9BA19 B9BVE1
395019.Bmul_0287 WP_006400626.1.100558 WP_006400626.1.101207 WP_006400626.1.11863 WP_006400626.1.17778 WP_006400626.1.19915 WP_006400626.1.23373 WP_006400626.1.23823 WP_006400626.1.24798 WP_006400626.1.24872 WP_006400626.1.25176 WP_006400626.1.26607 WP_006400626.1.37770 WP_006400626.1.38187 WP_006400626.1.38686 WP_006400626.1.42270 WP_006400626.1.42384 WP_006400626.1.43525 WP_006400626.1.4927 WP_006400626.1.49281 WP_006400626.1.51269 WP_006400626.1.52658 WP_006400626.1.54573 WP_006400626.1.55135 WP_006400626.1.58278 WP_006400626.1.60128 WP_006400626.1.60510 WP_006400626.1.62185 WP_006400626.1.66141 WP_006400626.1.66697 WP_006400626.1.66940 WP_006400626.1.67959 WP_006400626.1.7115 WP_006400626.1.73018 WP_006400626.1.74059 WP_006400626.1.78867 WP_006400626.1.81730 WP_006400626.1.82554 WP_006400626.1.84428 gi|189351760|ref|YP_001947388.1| gi|189351760|ref|YP_001947388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]