SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189351865|ref|YP_001947493.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189351865|ref|YP_001947493.1|
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.96e-100
Family Methylenetetrahydrofolate reductase 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189351865|ref|YP_001947493.1|
Sequence length 276
Comment NADPH-dependent methylenetetrahydrofolate reductase [Burkholderia multivorans ATCC 17616]
Sequence
MKPIELSFEFFPPKTADGVEKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLDAAPHLSCIGSSRDSLRAILDQYRSCGIRHIVALRGDLPSGMGSVGELRYASELVSF
IRAEHGDWFHIEVAGYPEYHPQARSPKADLENFARKVKAGANSAITQYFFNADAYFRFVD
DVRKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWVARRLESFGDDRESIRAFGADV
VTGLCQRLIDAGVPGLHFYTLNAAAATKAICERLDV
Download sequence
Identical sequences A0A0H3KIB2 A0A1B4MQD5 B9BC62 B9C039
WP_006401377.1.100558 WP_006401377.1.101207 WP_006401377.1.11863 WP_006401377.1.24798 WP_006401377.1.24872 WP_006401377.1.26607 WP_006401377.1.37770 WP_006401377.1.42270 WP_006401377.1.4927 WP_006401377.1.49281 WP_006401377.1.51269 WP_006401377.1.52658 WP_006401377.1.54573 WP_006401377.1.55135 WP_006401377.1.58278 WP_006401377.1.60128 WP_006401377.1.66940 WP_006401377.1.67959 WP_006401377.1.7115 WP_006401377.1.73018 WP_006401377.1.74059 WP_006401377.1.81730 WP_006401377.1.82554 WP_006401377.1.84428 gi|189351865|ref|YP_001947493.1| 395019.Bmul_0182 gi|189351865|ref|YP_001947493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]