SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189351923|ref|YP_001947551.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189351923|ref|YP_001947551.1|
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 8.24e-34
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189351923|ref|YP_001947551.1|
Sequence length 159
Comment hypothetical protein BMULJ_03141 [Burkholderia multivorans ATCC 17616]
Sequence
MFKHEVEIRRLPTQHGYAVAHVGAYMKVGDAFAQIGAWAARHGLVGRGAKMVGIYYDDPD
TVPEAQLRAQACIVPPDGAPAVEPDAPVERVTIAGGDYAVLLHTGPYAELKAAYQWLYGE
GLRQAGRAPAAAPPFERYLNTPLDTAPADLLTEIHVPVR
Download sequence
Identical sequences A0A0H3KIL0
gi|189351923|ref|YP_001947551.1| 395019.Bmul_0124 WP_012212485.1.17778 WP_012212485.1.23373 WP_012212485.1.23823 WP_012212485.1.54573 WP_012212485.1.74059 WP_012212485.1.78867 gi|189351923|ref|YP_001947551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]