SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189351934|ref|YP_001947562.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189351934|ref|YP_001947562.1|
Domain Number 1 Region: 643-1099
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-127
Family ALDH-like 0.000000224
Further Details:      
 
Domain Number 2 Region: 259-608
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.75e-122
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000478
Further Details:      
 
Domain Number 3 Region: 89-258
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 6.93e-65
Family N-terminal domain of bifunctional PutA protein 0.000000413
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000511
Family PutA pre-N-terminal region-like 0.00095
Further Details:      
 
Weak hits

Sequence:  gi|189351934|ref|YP_001947562.1|
Domain Number - Region: 1148-1262
Classification Level Classification E-value
Superfamily ALDH-like 0.00196
Family ALDH-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189351934|ref|YP_001947562.1|
Sequence length 1310
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Burkholderia multivorans ATCC 17616]
Sequence
MASTTLGVKVDDLLRSRLKDAATRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHSGVA
DLADGHATDGEDDNSPHPFLEFAQNVQPQSVLRAAITAAYRRPEPECVPFLIGQARLPAN
LQADVQSLATRLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDA
LIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGRGGEPL
IRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDAQRYYAS
YEQAIHAIGKAAGGRGIYEGPGISIKLSALHPRYSRSQQERTMTELLPRVRALALLARRY
DIGLNIDAEEADRLELSLDLLEALCFDPDLAGWNGIGFVVQGYQKRCPFVIDYLIDLARR
SRHRLMIRLVKGAYWDTEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQ
FATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTH
ETLLAYLVRRLLENGANTSFVNRIADKSVSVKELVADPVDEASKVVPLGAPHPKIPLPRN
LYGDERPNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALADAPARDVRNPADQ
RDIVGTVSEATAEHVSAALAHAVTAAPIWQATPVDARADCLVRAADLLEAQMHTLMGLIV
REAGKSLPNAIAEIREAVDFLRYYAAQIRGEFSNDTHRPLGPVVCISPWNFPLAIFMGQV
AAALAAGNTVLAKPAEQTPLIAAQAVRLLREAGVPAGAVQLLPGDGETVGAALVADPRTR
AVMFTGSTEVARLINKTLSTRLDPDGKPIPLIAETGGQNAMIVDSSALAEQVIADVMQSS
FDSAGQRCSALRVLCLQDDVADRTLTMLKGAMQELSLGNPDRLSTDVGPVIDADAKRTID
AHIATMKDKGHAVTQLAMPEACAHGTFVPPTLIEIGSIDELKREVFGPVLHVVRYRRSQL
DKLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLS
GTGPKAGGALYLQRLLATRPSGLPRSLAQSLVADGAAEGGERAHPAAALTALRDWLIEQR
EPALAARCDGYLAQVPAGATAVLTGPTGERNTYTLGPRGTVLCVAATPSGARAQLAAVLA
TGNRALFSGAAGEALVAALPASLKAHATVRKQADAAFDAVLFEGDSDELLTLVKEVAQRP
GPIVSVQGVSAGAFEHGDAEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences A0A0H3KIG4
395019.Bmul_0114 gi|189351934|ref|YP_001947562.1| WP_012212480.1.54573 WP_012212480.1.74059 gi|189351934|ref|YP_001947562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]