SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189351702|ref|YP_001947330.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189351702|ref|YP_001947330.1|
Domain Number 1 Region: 15-287
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.3e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000187
Further Details:      
 
Domain Number 2 Region: 288-310,356-444
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 8.5e-21
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189351702|ref|YP_001947330.1|
Sequence length 459
Comment ubiquinol-cytochrome c reductase cytochrome b subunit [Burkholderia multivorans ATCC 17616]
Sequence
MADNKEVSTTGLTGWIDQRFPLTTTWKKHVSEYYAPKNFNFWYFFGSLALLVLVNQIVTG
IFLTMNYKPDSMLAFASVEYIMREVPWGWLIRYMHSTGASMFFVVVYLHMFRGLMYGSYR
KPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFVGPDLSLWIRG
DYVVSDVTLNRFFAFHVIAIPLVLVGLVVAHLVALHEVGSNNPDGIEIKAKKDANGIPLD
GIPFHPYYSVHDFFGVCVFLMVFALIVFFAPEMGGYFLESNNFVPANPLQTPPEIAPVWY
FTAFYAMLRATTDPFKIVLMIVIALLGVLALIRARGKWKIGLPVLAAAIVVFMYLTESKF
WGVVVMGSAVITLFFLPWLDRSPVKSIRYRPLFHKVFLGIFVAAFLTLAFLGTRPPSPAA
TLIAQGCALIYFAFFLGMPVWTPLGTFKQPPERVRFKPH
Download sequence
Identical sequences A0A0H3KML5 A0A1B4MQW1 J4SNR6
gi|189351702|ref|YP_001947330.1| 395019.Bmul_0345 gi|189351702|ref|YP_001947330.1| WP_006411141.1.100558 WP_006411141.1.101207 WP_006411141.1.23373 WP_006411141.1.24798 WP_006411141.1.37770 WP_006411141.1.38686 WP_006411141.1.4927 WP_006411141.1.54573 WP_006411141.1.66697 WP_006411141.1.84428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]