SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189352402|ref|YP_001948029.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189352402|ref|YP_001948029.1|
Domain Number 1 Region: 218-356
Classification Level Classification E-value
Superfamily CBS-domain pair 6.95e-24
Family CBS-domain pair 0.0069
Further Details:      
 
Domain Number 2 Region: 361-443
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000115
Family CorC/HlyC domain-like 0.002
Further Details:      
 
Weak hits

Sequence:  gi|189352402|ref|YP_001948029.1|
Domain Number - Region: 106-169
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000778
Family Bacteriorhodopsin-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189352402|ref|YP_001948029.1|
Sequence length 447
Comment hypothetical protein BMULJ_03621 [Burkholderia multivorans ATCC 17616]
Sequence
MLQIFALIGALFLVALNGFFVAAEFGLVKLRATRVKTLARKHGLRGRILGVVHGRLDAYL
SACQLGITLASLGLGWIGEPAFAQLIGPLLDVLGVHSERVVHLISLVFAFSLISFLHIVV
GELAPKSMAIRQAEKVGLWVALPLYAFYWAMYPAIWLLNTSANAVLRLAGLSADHGGDAH
YSTDELKLILRSRRSTAGNTAPPGRGAYSNDEWNTLAHSLDFSSMTVSDLMRPAHEMIGL
RRDLPLPDNMEIVARHRFSRYPLFTDASRERVSGLIHLKDLLLARHAGAALDDLSDYVRP
VQYVQPDMPALDLFRRFRKGAPHFALVGNKGEKPIGFLTLDNLLGALVGQIHDEFRQGDA
DWTRLDDGTLMGKGSLPVVSLEQALGIDIDEGRAESVGGLVIQALNDLPSEGQRVSFDRF
DVVVKKMNGPRIVLVRVYPKVAKEADE
Download sequence
Identical sequences A0A0H3KKC7
gi|189352402|ref|YP_001948029.1| gi|189352402|ref|YP_001948029.1| WP_012217457.1.54573 WP_012217457.1.74059 395019.Bmul_4894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]