SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156740651|ref|YP_001430780.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156740651|ref|YP_001430780.1|
Domain Number 1 Region: 410-661
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 5.89e-60
Family Tetrapyrrole methylase 0.00083
Further Details:      
 
Domain Number 2 Region: 1-179,215-243
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 7.19e-56
Family CbiG N-terminal domain-like 0.00046
Further Details:      
 
Domain Number 3 Region: 229-352
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 1.7e-31
Family CobE/GbiG C-terminal domain-like 0.00049
Further Details:      
 
Domain Number 4 Region: 686-789
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.84e-17
Family Siroheme synthase N-terminal domain-like 0.0012
Further Details:      
 
Domain Number 5 Region: 794-832
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.0000000196
Family Siroheme synthase middle domains-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156740651|ref|YP_001430780.1|
Sequence length 837
Comment precorrin-3B C17-methyltransferase [Roseiflexus castenholzii DSM 13941]
Sequence
MSITIIAVTRAGARLAERLAPELNAVARVPAKFAGEAIIATPYTASLSDEVRYWWGRSRA
LALIMASGIAVRTIVPLISHKTTDPAVVCLDEAGRFVIPLIGGHQAGANDLARRIAALTG
GQAAITTASDTQGFPALDMIGRNKGWRIAGDSALTHTMACLVNGDLIGCWVEPDLPDARR
WMENHLALCPNIEFVNTAADLMDARYAAALLVTHHQINDLWKKLRAKSVRYLPPVLVVGI
GCRRGVSVDELYDALRTTLADAGLDERCVGALATAEIKADEPGLIALANRLAIPLHVVST
AELAALDATKFSRSAATVHFDLPGVAEPCAVIVSGGPLLVPKRAFPRCTIATTLAEHGTL
RGTRHMGAHGSTRIGTNSHGSIVSHPAPNREHPSHPRKSVVPSRPTIPKHDQPSGVLTLV
SIGPGDPQHLTFAAREALRRAEIVAGYRVYIDLALPLLQPHQEVLVTPAMGDEAGRARHA
IELARAGRRVALISSGDIGIYAMAAPVFEALRDDGWTGDDPVVEVIPGISAFQALAARLG
APVSHDFCVISLSDLLTPWEVIERRLRAAAQADFVVALYNPRSRGRDWQLDAALRILRTH
RPPTTPVAFGRNVSRDDEHVILTTLAAADPLDADMFTVVLVGNSQSYMLGERMATPRGYT
ARAQSEANRSEAFPASNQTPREYPIVLTDTSRLSAIVIGGGAVGERKVRGLLEVGASVRL
VSPTATPQLAAWAEAGRITWDQRAYTQGDLAGALLAFAATSDRSVNSRIARDAAVAGILC
NVADAPEEGCFHVPAVYRSGGVTIAVSSGGAAPARAAALRDAIAQWLGQSLNIEGHR
Download sequence
Identical sequences A7NH15
383372.Rcas_0637 gi|156740651|ref|YP_001430780.1| WP_012119193.1.48654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]