SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156741255|ref|YP_001431384.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156741255|ref|YP_001431384.1|
Domain Number 1 Region: 67-125
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0000000405
Family F1F0 ATP synthase subunit B, membrane domain 0.003
Further Details:      
 
Weak hits

Sequence:  gi|156741255|ref|YP_001431384.1|
Domain Number - Region: 29-75,106-111
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0398
Family Arfaptin, Rac-binding fragment 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156741255|ref|YP_001431384.1|
Sequence length 163
Comment F0F1 ATP synthase subunit B [Roseiflexus castenholzii DSM 13941]
Sequence
MEKLGINWGLLIAQLINVVFVVWLLTTFLYRPILNMLNQRTNRIQEGLQDAERVREQLAN
AKRDYDAELAKARQEAASILAQAQERARAQAAEIIAQAHRDAEKIKSDTLAQAEQERQRM
LGELKDRMAELVVLTAERVLNAELKANHDRLIEESLAELGKYN
Download sequence
Identical sequences A7NIR3
383372.Rcas_1269 WP_012119796.1.48654 gi|156741255|ref|YP_001431384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]