SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156741564|ref|YP_001431693.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156741564|ref|YP_001431693.1|
Domain Number 1 Region: 73-199
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000000000361
Family MJ1460-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156741564|ref|YP_001431693.1|
Sequence length 201
Comment bacteriochlorophyll 4-vinyl reductase [Roseiflexus castenholzii DSM 13941]
Sequence
MTTRAARGTGKIGPNAIIQTVAALRDRLGDEAARATLVRGGAGDLPDHLPRELIDEHEFH
ALVELLLEQIGEEQTNLVMARSGQLTSEYVFANRIPAFARLLLRLLPPSWGLRLLLPAMQ
RHTWTFAGSGVFAYDLTPTPSISITNGALFDTPAMAAAMCAYYRGAFEQMFRKLICSRAT
LHDLECQARGDRRCRYAIRCR
Download sequence
Identical sequences A7NJK5
gi|156741564|ref|YP_001431693.1| WP_012120103.1.48654 383372.Rcas_1582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]