SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156741604|ref|YP_001431733.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156741604|ref|YP_001431733.1|
Domain Number 1 Region: 379-445
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000114
Family NfeD domain-like 0.0041
Further Details:      
 
Domain Number 2 Region: 37-194
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0000000000116
Family Biotin dependent carboxylase carboxyltransferase domain 0.052
Further Details:      
 
Weak hits

Sequence:  gi|156741604|ref|YP_001431733.1|
Domain Number - Region: 244-377
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00863
Family Glycerol-3-phosphate transporter 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156741604|ref|YP_001431733.1|
Sequence length 464
Comment hypothetical protein Rcas_1623 [Roseiflexus castenholzii DSM 13941]
Sequence
MPANCSSHQRSGMLIAALAIALLLLVWPAGSARAQQSGGPLYLIEVSGIVSAPTIDYLRR
AVQIAEASSADALIISYSSTGGVLRDVRVFAAEVAQARVPIVVFITPRGTQAGPAGALFV
TAAHISALSPDTSFGSPFPLAQVDDTLSQQTRDLLLDNVSSQMRKWNETRGRNAEWIDRA
VREGVILNNQQAISLDPPAIDLVAADLRELLTLIDGRIVTLDDGRVVRISSIGRMPTPIE
PTLFESLRLALTDPTVAFALLVLGSMAIYLELNTPGIGLFAGAGFLLLLGAAAGFLALPV
LWWAMTLVILGLVLIGAEFVAPTHGGLMITGLVMLGIGGGNLIDATQAPGAGVAWWALLI
VIGGIAATAALGLALALRSRKRPAAIGTEALVGRLAQVRRRLDPRGMVFVEGALWQAISE
TDPVEVGDWVRVVAVHNLQLIVRPLESEESTTREAQPPSTGRVV
Download sequence
Identical sequences A7NJP5
WP_012120143.1.48654 383372.Rcas_1623 gi|156741604|ref|YP_001431733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]