SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156742246|ref|YP_001432375.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156742246|ref|YP_001432375.1|
Domain Number 1 Region: 170-213,252-449,548-665
Classification Level Classification E-value
Superfamily Subtilisin-like 6.02e-66
Family Subtilases 0.0015
Further Details:      
 
Domain Number 2 Region: 461-525
Classification Level Classification E-value
Superfamily PA domain 0.00000183
Family PA domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156742246|ref|YP_001432375.1|
Sequence length 1115
Comment protease domain-containing protein [Roseiflexus castenholzii DSM 13941]
Sequence
MKRYTTRLSLAAMTLLLSLILAALSPLRAVEAQTRPNRPTPGTPLTIEPATVTNREDLAV
NKNMAVSRDGSMASVFLKIDSPSLATFMAQNGITDMNALAAQNYLRQLNAELDALVARAK
QLVPGLSVTHRFDLIIGGVAVVAPVGEIDKLRRLPNVVDVINDRIEKIETYRTPAFIGAT
TAWGRGGGSAFAGEGVIFGVLDSGVWPEHPSFSDPDPLGKPYAPPPPAPGNPGGVRACDF
GSATPGDAPFACNNKLIGSYRFMTAYDFFVGTEPYEFRSGRDDDGHGTHTASTAAGNRGV
AASDGSRVFGVISGIAPRAYVVNYKVCGELGCFSTDSAAAVQQAIRDGVHVINFSISGGT
NPYSDIASLAFLDAYNAGVLVSASAGNSGPAADTVNHREPWVATVGASTSDRSYLSTLTV
QGSSGTFTAVGASSGAGIATPTQIVVNNADPLCLNPAAPGSFTGQIVVCQRGVIARVAKS
ANVAAGGAVGMILYNPSPSSLDADFHVIPTVHIQNTDGTALLAFLTANPGATATFTAGAP
GSIQGDVMAGFSSRGGPGQTLGISKPDVTAPGVNILAGYTAIEYGTPVPQFAFLSGTSMS
SPHNAGAAILLKWLHPTWTPGQIKSALMTTAKAAGVFKEDGVTPFTPFDAGSGRINLRKA
WDPGLTFDETGANYVTLQNELWKANYPSLYVPKMPGLITVSRTAREVSGYDSFYKSTVSY
QAGQPRDFTVTAPKEFFVPANGTYTFDITVDARNVPVGQVRHAVVIFTERNGCQVRFPIT
IVRGEPDIRMEKRCNPATLALRGTTDCTITISNTTFSNASVTLNDTMPRQLKLVSGSVTG
GATEMGNGLTYSGTLTGAAPPDVSAGRLTFNGYLSLASLGASPNVSLGDESLVNLTLSRP
FLFGGQSYNTVAMVSNGYAVVGGGTAADISFVNRTFPNSARPNNTLGAFWTDLDGSAGGN
YYAYLVGFGPCSNPANACWLILEWENAPNWSDSQVNTFQIWIGLNGVEDITYSYGPVLSS
GDGGFVTVGAENAFGNRGANIYSNDGFGPVIGTIPTAGSNDVYIATTPGAPGQTVTIGFR
AQGVRVGRWTNYAELTSPAFFGTYIKSFSGEVVRP
Download sequence
Identical sequences A7NLH4
383372.Rcas_2274 WP_012120781.1.48654 gi|156742246|ref|YP_001432375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]