SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156743803|ref|YP_001433932.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156743803|ref|YP_001433932.1|
Domain Number 1 Region: 4-388
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.49e-106
Family Homocysteine S-methyltransferase 0.00000154
Further Details:      
 
Domain Number 2 Region: 925-1203
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 4.32e-80
Family Methionine synthase SAM-binding domain 0.0027
Further Details:      
 
Domain Number 3 Region: 346-614
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.03e-77
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0005
Further Details:      
 
Domain Number 4 Region: 737-886
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.14e-34
Family Cobalamin (vitamin B12)-binding domain 0.0000905
Further Details:      
 
Domain Number 5 Region: 698-750
Classification Level Classification E-value
Superfamily Methionine synthase domain 0.00000000000000837
Family Methionine synthase domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156743803|ref|YP_001433932.1|
Sequence length 1208
Comment methionine synthase [Roseiflexus castenholzii DSM 13941]
Sequence
MKKPTYLEALCERVLIYDGAMGTSIDTFHLTAADYGGEQTFGARDYLVITRPDVIEQIHA
SFLEAGADVLETCTFQSTRPRLEEWGLADQTHAINVAAARLARRVADAFEARDGRPRYVA
GSMGPTGKLPSSDDPALSDVTFDQLSDIFYEQATALIEGGVDVLLVETSVDILEVKAALD
GIRRAKADLNRPDVAVQAQVFLDLSGKMLLGTEVPAIIATLEAMPVDVIGLNCSTGPEHM
REAIRYMTRHSRKPISCIPNAGLPIEVNGETVYPMEPEPFARILGEYVHEYGVAVVGGCC
GTRPAHIRRLREVVGFVPPKVRDIEYIPSVSSGVRAAALRQEGTLTIIGERVNTLGSRKV
KRLLLNEDYDGVLEVAREQVDSGAHLLDVCVAMTERSDEREMMVKLVKKLTMNVELPLVI
DTTEADVLEAALAIYPGRAVVNSVSLEGGRGDKIDRTMPLVARYGAATIAMTIDEEGMAH
TAERKLAIAQRIAQIAQDEYGVPNEALIFDVLTFPITTGQAELRRAAIETIEGIRLVKQH
IPGCFTTLGVSNLSFGVAPHARATLNSVFLKHAVDAGLDTAIINPAHVTPYAEIPPEHIK
VCEDLIFDRDDQALARFIQFFEEHAADAKTERADPTEGMTAAQRIHWKIVHRKKEGIEAD
IDQVIAERIGDMEARAGNGVSNPDRRSHESLVASPFRNAAAVDVLNTVLLPAMKEVGDLF
GAGQLILPFVLQSAEVMKRAVAHLEQYLEKLEGVTKGKIVLATVYGDVHDIGKNLVHTIL
ANNGYTVYDLGKQVPINTIIEKAVEVNADAIGLSALLVSTSKQMPLCVQELYRRGLKFPV
LVGGAAINKQYGQRILFVDDNTPYEPGVFYCKDAFEGLETVDALADPTTRAAFVERTKAE
AAEALGKKQRGRVALAELGRATLSDAAKVRSAVRTDVPVPTPPFWGAKVVRRIKLADVVE
CLDRNALYRLQWGAKNAKGEEWERLKAEFDAKVRDLVREAERDGWLEPQVVYGYYPCQSD
GHEVIVYDPPSTLNGAQPRELTRFVFPRQPERERLCLADYFRSRESGEYDVVALQIVTMG
RKVDDLTETLQHAGDYARAYFIHGLGVSLAEALAEYTNRLIRQQLGLKGTQGKRYSWGYP
ACPDLEEHEKLFRVLPADQIGVSLTEAWQLVPEQSTAAIVIHHPEAKYFSIGSARERAEE
DVAETLSI
Download sequence
Identical sequences A7NQR8
383372.Rcas_3878 WP_012122337.1.48654 gi|156743803|ref|YP_001433932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]