SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156741181|ref|YP_001431310.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156741181|ref|YP_001431310.1|
Domain Number 1 Region: 166-262
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-23
Family Anti-sigma factor antagonist SpoIIaa 0.002
Further Details:      
 
Domain Number 2 Region: 53-150
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000452
Family Histidine kinase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156741181|ref|YP_001431310.1|
Sequence length 269
Comment anti-sigma-factor antagonist [Roseiflexus castenholzii DSM 13941]
Sequence
MSNAPPQRRMMRTVCAHRLMTGIPMESLTVPATLESLAQISAFVGEATQRAGLDEHAAWQ
VELAVDEAATNIIQHGYDPGKPGIIELTWRIENNRLIITLRDYGRRFNPDDVPPPDLSSP
LEERQPGGLGLYLMNRLMDQVRFDFDDANGNLLTMVKEILPRVQAHEFRLSGRLDAVGTA
TALAPVHRAIADGAEYVLLDFDDVTFLSSTALRSLLLARKELLERNGELRLCNLRPQVRE
VFELTGFTRIFAIHSSRNEALAAFGQEHA
Download sequence
Identical sequences A7NIJ2
383372.Rcas_1195 WP_012119722.1.48654 gi|156741181|ref|YP_001431310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]