SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156742342|ref|YP_001432471.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156742342|ref|YP_001432471.1|
Domain Number 1 Region: 443-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.86e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156742342|ref|YP_001432471.1|
Sequence length 604
Comment sulfate transporter [Roseiflexus castenholzii DSM 13941]
Sequence
MLAMLKRLSLFQILQREFSTYDMAHFQRDLLAGLTVAAVGLPLALAFGVASGADAAAGLV
TAILAGLIIGGLGGAGYQISGPTGAMSAVLIVLASRYGLDGVWVATVMAGIFLIALGVFR
LGRYVSFIPSPVITGFTSGIALIIAIGQIDNVLGVTTPKAENALEKLWHYVTNPVVPDWH
TLALAGIVMGTMILLPRVTTRIPGSLVGIMIASPLAFFAGWDVAVIGDIPRTILLSNRLT
LESIPWEHLSELLPAAVSIAALGAIESLLCGTVGATMSGGEFDSNQELIGQGIGNLVIPF
FGGVPATAAIARTSVAIKSGAATRLTSIIHSLALLLSALALAPLISHVPLAALGDVLLVT
AWRMNEWESIHFFVRTRLRGALTGMIVTMIATAALDLTQAILIGVVISAVLYIRQSAIST
SVASGPVKPEKIRAQGFDLPAACPAIHVYYLTGPVFFGSVTTVLESFETAGDYHTLIISM
RGVPVVDAMGIQALQQIVEEHHHRGGKVYFSGLQPAVRSMFDRTGLTQLVGEEYIFWDAA
QAIIASHQSHELDGCAKCDSRSEICDVLRAARRRHVESDEAAAPAVATDSFPSTNMTSVS
SVQG
Download sequence
Identical sequences A7NLQ7
WP_012120877.1.48654 gi|156742342|ref|YP_001432471.1| 383372.Rcas_2371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]