SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156744014|ref|YP_001434143.1| from Roseiflexus castenholzii DSM 13941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156744014|ref|YP_001434143.1|
Domain Number 1 Region: 5-178,916-1005
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.51e-20
Family ABC transporter ATPase domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 481-559
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.000000000772
Family Rad50 coiled-coil Zn hook 0.01
Further Details:      
 
Domain Number 3 Region: 622-792,871-1017
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000113
Family ABC transporter ATPase domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156744014|ref|YP_001434143.1|
Sequence length 1022
Comment SMC domain-containing protein [Roseiflexus castenholzii DSM 13941]
Sequence
MIPRTLTLQNFMCYREGLPPLVLDGISIACLAGDNGAGKSALLDAITWALWGEARLKSDD
DLVALGATEMMVDLEFTLDGQDYRVIRRRIRGKRGGQSQLDFQVRDENGWRSLTPGGIRE
TQQLIIRTLRMDYEVFANSAYLRQGHADEFTRKEPAKRKQVLADILGLSVYEDLESRAKE
RARAIEGQIRGLEGQIGELRRQAERRDVLVGFVRDAEQRVADARQRITEAEQAFQAAVAK
VQELETVRTIRDNRQEQIHQRRAERDAQKQWLDRQMDIRERAEGWIARRAEIEEGIRALR
AAEAERDRLAALRDEYDRLQQRRATLVQALAEAEHALRADLRVAETQVQTMRERAARRPK
LVAERERLAAQLTDQTPMIEALSAARTRRTDLTDRLRRVNELLRRRTELEGDIKLKHDSL
VATREEQKRILRTLADQLKHETRWRAELAEALAERTRINEEKDCLEILRNDERVLAEQVG
GIRAECETVRRQGEQINEKLRLLGPDVTVCPLCKSELGHDGIVHIQAEYERERQALRQWY
AAAKRDADQLEAQLKRLRNDIRAAENRIAALPDLQGRIARLESDLARCDTLRQQQIEAQR
LHDDVAMRLMKNDYELAAREELKRIDAEMTALGAIETLEREIGALDRQVAALENRSREQA
TLQAQVDALHREIRQIDDDDPALHEQEQIVAELSRRLAQNDFAHDERAALATLDEQIAAL
GYSRERYDQAKAEAQALTRWEEDLTRLQHAEEWIAENDDDIARAAERLRQLDAQIASDEA
EVQRLDERLRDLAPAARARDAARARLDDLHRELLAFQKDLGEHEANLRRAEEAARGLADA
EALRLALLERKSLFDELTLAFGKKGVQAMLIETALPELEREANRLLDRMTDNQLHLTFET
QRDTKKGDVVETLEIKIADALGTRVYDAYSGGEAFRLDFAIRIALSKLLARRAGARLETL
IIDEGFGSQDARGRERLVEAIISVQHDFRRVLVITHIQELKDMFPVQIEIVKTPHGSVWS
LA
Download sequence
Identical sequences A7NRC9
383372.Rcas_4093 WP_012122546.1.48654 gi|156744014|ref|YP_001434143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]