SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161616214|ref|YP_001590179.1| from Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161616214|ref|YP_001590179.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.46e-111
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.65e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000941
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-27
Family C-terminal domain of adrenodoxin reductase-like 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161616214|ref|YP_001590179.1|
Sequence length 672
Comment hypothetical protein SPAB_04018 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYASRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDITGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
ALTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A1X2RMT9 A0A2D1Y129 A0A2D1YE10
CP000886|CDS_3346608-3348626 NZ_ACBF01000001|CDS_545479-547497 gi|161616214|ref|YP_001590179.1| WP_000121521.1.100438 WP_000121521.1.101815 WP_000121521.1.1137 WP_000121521.1.11936 WP_000121521.1.12484 WP_000121521.1.15100 WP_000121521.1.15586 WP_000121521.1.1592 WP_000121521.1.16581 WP_000121521.1.1668 WP_000121521.1.17703 WP_000121521.1.18192 WP_000121521.1.19030 WP_000121521.1.19357 WP_000121521.1.21089 WP_000121521.1.21692 WP_000121521.1.21981 WP_000121521.1.22676 WP_000121521.1.24376 WP_000121521.1.24555 WP_000121521.1.27776 WP_000121521.1.28393 WP_000121521.1.28775 WP_000121521.1.31927 WP_000121521.1.32424 WP_000121521.1.41048 WP_000121521.1.41050 WP_000121521.1.42276 WP_000121521.1.42328 WP_000121521.1.4239 WP_000121521.1.42491 WP_000121521.1.43299 WP_000121521.1.43873 WP_000121521.1.46243 WP_000121521.1.50593 WP_000121521.1.51331 WP_000121521.1.54607 WP_000121521.1.55554 WP_000121521.1.55614 WP_000121521.1.58372 WP_000121521.1.58834 WP_000121521.1.60213 WP_000121521.1.60507 WP_000121521.1.61087 WP_000121521.1.62677 WP_000121521.1.69588 WP_000121521.1.70869 WP_000121521.1.70914 WP_000121521.1.71007 WP_000121521.1.71069 WP_000121521.1.71120 WP_000121521.1.71248 WP_000121521.1.76532 WP_000121521.1.79203 WP_000121521.1.79427 WP_000121521.1.79867 WP_000121521.1.80868 WP_000121521.1.82037 WP_000121521.1.83710 WP_000121521.1.84711 WP_000121521.1.8722 WP_000121521.1.88845 WP_000121521.1.90211 WP_000121521.1.91107 WP_000121521.1.92044 WP_000121521.1.92758 WP_000121521.1.94379 WP_000121521.1.94562 WP_000121521.1.9530 WP_000121521.1.96758 WP_000121521.1.97983 272994.SPAB_04018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]