SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161616474|ref|YP_001590439.1| from Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161616474|ref|YP_001590439.1|
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.48e-107
Family G proteins 0.0000000259
Further Details:      
 
Domain Number 2 Region: 486-610
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.32e-40
Family Translational machinery components 0.0000119
Further Details:      
 
Domain Number 3 Region: 271-411
Classification Level Classification E-value
Superfamily Translation proteins 8.84e-36
Family Elongation factors 0.00012
Further Details:      
 
Domain Number 4 Region: 611-700
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.04e-27
Family EF-G/eEF-2 domains III and V 0.0003
Further Details:      
 
Domain Number 5 Region: 411-488
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.02e-25
Family EF-G/eEF-2 domains III and V 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161616474|ref|YP_001590439.1|
Sequence length 704
Comment elongation factor G [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
Sequence
MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERG
ITITSAATTAFWSGMAKQYEPHRINIIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQ
PQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVGQIKTRLGANPVPLQLAIGAEEGFT
GVVDLVKMKAINWNDADQGVTFEYEDIPADMQDLANEWHQNLIESAAEASEELMEKYLGG
EELTEEEIKQALRQRVLNNEIILVTCGSAFKNKGVQAMLDAVIDYLPSPVDVPAINGILD
DGKDTPAERHASDDEPFSALAFKIATDPFVGNLTFFRVYSGVVNSGDTVLNSVKTARERF
GRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCDPENPIILERMEFPEPVISIAV
EPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREFNVE
ANVGKPQVAYREAIRAKVTDIEGKHAKQSGGRGQYGHVVIDMYPLEPGSNPKGYEFINDI
KGGVIPGEYIPAVDKGIQEQLKSGPLAGYPVVDLGVRLHFGSYHDVDSSELAFKLAASIA
FKEGFKKAKPVLLEPIMKVEVETPEENTGDVIGDLSRRRGMLKGQESEVTGVKIHAEVPL
SEMFGYATQLRSLTKGRASYTMEFLKYDDAPNNVAQAVIEARGK
Download sequence
Identical sequences A0A089HHI5 A0A0F6B7P3 A0A0F7JCF3 A0A0G2NU76 A0A0H3NMG4 A0A0L3J935 A0A0L9EKM9 A0A0M0PQK4 A0A0R9PG54 A0A0T7RUB6 A0A0U1GFR7 A0A0V2EH53 A0A1C2ZSB4 A0A1M3XSQ9 A0A1R2USU1 A0A1S0ZTM7 A0A1S1AFX1 A0A1X2RGX6 A0A1X2TQS8 A0A1X2UYA1 A0A1X2Y5F7 A0A1Z3Q7W4 A0A221YQW6 A0A221Z7Z9 A0A265BA31 A0A267SKJ8 A0A271CD75 A0A271CTL3 A0A2C6G290 A0A2C9NVU4 A0A2D1X993 A0A2D1XLK1 A0A2D3TQZ6 A0A2G1P0V4 A0A2H9YAE9 A0A2I6M342 A0A2I6MGN5 A0A2I6MUF0 A0A2I6N8J0 A0A2I6NL73 A0A2I6NZ44 A0A2K2RXE6 A0A2K2SGH8 A0A2K2SLE9 A0A2K2T5H3 A0A2K2T9P0 A0A2K2ZHL0 A9MT06 B4SUU6 B4TKM1 B4TXE8 B5BGZ2 B5F8F8 B5FJM0 B5R297 B5RH09 C0Q0C2 E8XDZ1 G4C7A7 G5LF48 G5LUK0 G5MP66 G5NIY9 G5PTP1 G5Q8N1 G5QQN6 G5R6J8 G5RLL1 G5S1V2 G5SHK6 M7RC12 P0A1H3 P0A1H4 Q57J26 Q5PIW3 S4I5M2 S5HPU7 V1WVG8 V7IQ86 V7V297
gi|378986040|ref|YP_005249196.1| ABAK02000001|CDS_2919067-2916953 ABAM02000001|CDS_3974972-3972858 ABEJ01000002|CDS_2400-286 ABEW01000004|CDS_487788-489902 ABFG01000002|CDS_448269-450383 ABFH02000001|CDS_1569260-1571374 AE006468|CDS_3601672-3599558 AE014613|CDS_4212478-4214592 AE017220|CDS_3556115-3554001 AL513382|CDS_4227831-4229945 AM933172|CDS_3483288-3481174 AM933173|CDS_4215077-4217191 CP000026|CDS_3408059-3405945 CP000857|CDS_3534590-3532476 CP000886|CDS_3560307-3558193 CP001113|CDS_3583689-3581575 CP001120|CDS_3615967-3613853 CP001127|CDS_3499585-3497471 CP001138|CDS_3517686-3515572 CP001144|CDS_3642471-3640357 CP001363|CDS_3615530-3613416 FM200053|CDS_3403735-3401621 FN424405|CDS_3624770-3622656 NZ_ACBF01000029|CDS_2305-191 gi|482906014|ref|YP_007904574.1| gi|452122741|ref|YP_007472989.1| gi|161616474|ref|YP_001590439.1| gi|205354926|ref|YP_002228727.1| gi|525828801|ref|YP_008251766.1| NP_458454.1.84458 NP_462350.1.58477 WP_000124693.1.100002 WP_000124693.1.100007 WP_000124693.1.100008 WP_000124693.1.100010 WP_000124693.1.100017 WP_000124693.1.100031 WP_000124693.1.100036 WP_000124693.1.100077 WP_000124693.1.100079 WP_000124693.1.100115 WP_000124693.1.100129 WP_000124693.1.10013 WP_000124693.1.100137 WP_000124693.1.100149 WP_000124693.1.100165 WP_000124693.1.100191 WP_000124693.1.100196 WP_000124693.1.1002 WP_000124693.1.100234 WP_000124693.1.100258 WP_000124693.1.100266 WP_000124693.1.100284 WP_000124693.1.100288 WP_000124693.1.100313 WP_000124693.1.100314 WP_000124693.1.100321 WP_000124693.1.100354 WP_000124693.1.100392 WP_000124693.1.100412 WP_000124693.1.100413 WP_000124693.1.100421 WP_000124693.1.100424 WP_000124693.1.100432 WP_000124693.1.100436 WP_000124693.1.100438 WP_000124693.1.100446 WP_000124693.1.100450 WP_000124693.1.100457 WP_000124693.1.100472 WP_000124693.1.100484 WP_000124693.1.100488 WP_000124693.1.100502 WP_000124693.1.100521 WP_000124693.1.100541 WP_000124693.1.100557 WP_000124693.1.100584 WP_000124693.1.100589 WP_000124693.1.100592 WP_000124693.1.100597 WP_000124693.1.100605 WP_000124693.1.100610 WP_000124693.1.100642 WP_000124693.1.10065 WP_000124693.1.100650 WP_000124693.1.100707 WP_000124693.1.100711 WP_000124693.1.100714 WP_000124693.1.100721 WP_000124693.1.100730 WP_000124693.1.100732 WP_000124693.1.100733 WP_000124693.1.100739 WP_000124693.1.10074 WP_000124693.1.100750 WP_000124693.1.10076 WP_000124693.1.100764 WP_000124693.1.100773 WP_000124693.1.100776 WP_000124693.1.100781 WP_000124693.1.100790 WP_000124693.1.100793 WP_000124693.1.100799 WP_000124693.1.10081 WP_000124693.1.100857 WP_000124693.1.100865 WP_000124693.1.100869 WP_000124693.1.100870 WP_000124693.1.100871 WP_000124693.1.100882 WP_000124693.1.100886 WP_000124693.1.100895 WP_000124693.1.100932 WP_000124693.1.100941 WP_000124693.1.100944 WP_000124693.1.100948 WP_000124693.1.100953 WP_000124693.1.100979 WP_000124693.1.101007 WP_000124693.1.101011 WP_000124693.1.101020 WP_000124693.1.101042 WP_000124693.1.101074 WP_000124693.1.101078 WP_000124693.1.10108 WP_000124693.1.101091 WP_000124693.1.101094 WP_000124693.1.101111 WP_000124693.1.101112 WP_000124693.1.101123 WP_000124693.1.101126 WP_000124693.1.101147 WP_000124693.1.101180 WP_000124693.1.101185 WP_000124693.1.101199 WP_000124693.1.101223 WP_000124693.1.101226 WP_000124693.1.101239 WP_000124693.1.10124 WP_000124693.1.101259 WP_000124693.1.101271 WP_000124693.1.101284 WP_000124693.1.101291 WP_000124693.1.1013 WP_000124693.1.101312 WP_000124693.1.101320 WP_000124693.1.101322 WP_000124693.1.101353 WP_000124693.1.101363 WP_000124693.1.101374 WP_000124693.1.101386 WP_000124693.1.101404 WP_000124693.1.101420 WP_000124693.1.101425 WP_000124693.1.101454 WP_000124693.1.101473 WP_000124693.1.101519 WP_000124693.1.101520 WP_000124693.1.101541 WP_000124693.1.101589 WP_000124693.1.101609 WP_000124693.1.101612 WP_000124693.1.101616 WP_000124693.1.101634 WP_000124693.1.101636 WP_000124693.1.101639 WP_000124693.1.10164 WP_000124693.1.101666 WP_000124693.1.101674 WP_000124693.1.101707 WP_000124693.1.101724 WP_000124693.1.101734 WP_000124693.1.101740 WP_000124693.1.101741 WP_000124693.1.101744 WP_000124693.1.101759 WP_000124693.1.10177 WP_000124693.1.101776 WP_000124693.1.101815 WP_000124693.1.101832 WP_000124693.1.101839 WP_000124693.1.101841 WP_000124693.1.101868 WP_000124693.1.101878 WP_000124693.1.101890 WP_000124693.1.101904 WP_000124693.1.10191 WP_000124693.1.101917 WP_000124693.1.101927 WP_000124693.1.101941 WP_000124693.1.101949 WP_000124693.1.101953 WP_000124693.1.101975 WP_000124693.1.102009 WP_000124693.1.102050 WP_000124693.1.102087 WP_000124693.1.102103 WP_000124693.1.102111 WP_000124693.1.10220 WP_000124693.1.10231 WP_000124693.1.10237 WP_000124693.1.10266 WP_000124693.1.10276 WP_000124693.1.10293 WP_000124693.1.10300 WP_000124693.1.10310 WP_000124693.1.10338 WP_000124693.1.1038 WP_000124693.1.10394 WP_000124693.1.104 WP_000124693.1.10401 WP_000124693.1.10428 WP_000124693.1.10429 WP_000124693.1.10439 WP_000124693.1.10459 WP_000124693.1.10463 WP_000124693.1.10465 WP_000124693.1.10475 WP_000124693.1.10498 WP_000124693.1.10507 WP_000124693.1.10511 WP_000124693.1.10514 WP_000124693.1.10521 WP_000124693.1.10530 WP_000124693.1.10532 WP_000124693.1.10547 WP_000124693.1.10562 WP_000124693.1.10566 WP_000124693.1.10568 WP_000124693.1.10595 WP_000124693.1.106 WP_000124693.1.10631 WP_000124693.1.10642 WP_000124693.1.10654 WP_000124693.1.10675 WP_000124693.1.10677 WP_000124693.1.10678 WP_000124693.1.10711 WP_000124693.1.10720 WP_000124693.1.10753 WP_000124693.1.10755 WP_000124693.1.10797 WP_000124693.1.10857 WP_000124693.1.10868 WP_000124693.1.10873 WP_000124693.1.10898 WP_000124693.1.10926 WP_000124693.1.10936 WP_000124693.1.10992 WP_000124693.1.11000 WP_000124693.1.11012 WP_000124693.1.11024 WP_000124693.1.11031 WP_000124693.1.11041 WP_000124693.1.11055 WP_000124693.1.11098 WP_000124693.1.1110 WP_000124693.1.11119 WP_000124693.1.11126 WP_000124693.1.11142 WP_000124693.1.11156 WP_000124693.1.11168 WP_000124693.1.11190 WP_000124693.1.11213 WP_000124693.1.11216 WP_000124693.1.11239 WP_000124693.1.11253 WP_000124693.1.11254 WP_000124693.1.11295 WP_000124693.1.113 WP_000124693.1.11304 WP_000124693.1.11314 WP_000124693.1.1135 WP_000124693.1.11362 WP_000124693.1.11369 WP_000124693.1.11385 WP_000124693.1.11405 WP_000124693.1.1142 WP_000124693.1.11426 WP_000124693.1.11429 WP_000124693.1.11444 WP_000124693.1.11455 WP_000124693.1.11458 WP_000124693.1.11479 WP_000124693.1.1150 WP_000124693.1.11511 WP_000124693.1.11518 WP_000124693.1.11526 WP_000124693.1.11528 WP_000124693.1.11532 WP_000124693.1.11543 WP_000124693.1.11544 WP_000124693.1.11557 WP_000124693.1.1156 WP_000124693.1.11565 WP_000124693.1.11567 WP_000124693.1.11588 WP_000124693.1.11603 WP_000124693.1.11621 WP_000124693.1.11638 WP_000124693.1.11677 WP_000124693.1.11681 WP_000124693.1.11687 WP_000124693.1.1169 WP_000124693.1.11735 WP_000124693.1.1174 WP_000124693.1.11763 WP_000124693.1.11772 WP_000124693.1.11810 WP_000124693.1.11824 WP_000124693.1.11834 WP_000124693.1.11841 WP_000124693.1.11865 WP_000124693.1.11868 WP_000124693.1.11875 WP_000124693.1.11883 WP_000124693.1.11897 WP_000124693.1.11900 WP_000124693.1.11908 WP_000124693.1.11914 WP_000124693.1.11936 WP_000124693.1.11938 WP_000124693.1.11964 WP_000124693.1.11978 WP_000124693.1.12007 WP_000124693.1.12017 WP_000124693.1.12025 WP_000124693.1.12027 WP_000124693.1.1204 WP_000124693.1.12040 WP_000124693.1.12047 WP_000124693.1.12059 WP_000124693.1.12061 WP_000124693.1.12063 WP_000124693.1.1207 WP_000124693.1.12106 WP_000124693.1.12141 WP_000124693.1.12144 WP_000124693.1.1215 WP_000124693.1.12159 WP_000124693.1.12160 WP_000124693.1.12168 WP_000124693.1.12172 WP_000124693.1.12192 WP_000124693.1.12210 WP_000124693.1.1224 WP_000124693.1.12244 WP_000124693.1.12280 WP_000124693.1.12282 WP_000124693.1.12308 WP_000124693.1.12340 WP_000124693.1.12351 WP_000124693.1.12364 WP_000124693.1.12370 WP_000124693.1.12374 WP_000124693.1.1239 WP_000124693.1.12396 WP_000124693.1.12397 WP_000124693.1.12398 WP_000124693.1.12441 WP_000124693.1.12456 WP_000124693.1.1246 WP_000124693.1.12472 WP_000124693.1.12484 WP_000124693.1.12485 WP_000124693.1.1250 WP_000124693.1.12546 WP_000124693.1.12568 WP_000124693.1.12569 WP_000124693.1.12581 WP_000124693.1.12584 WP_000124693.1.12585 WP_000124693.1.12620 WP_000124693.1.1264 WP_000124693.1.12648 WP_000124693.1.12650 WP_000124693.1.12683 WP_000124693.1.12696 WP_000124693.1.12701 WP_000124693.1.12718 WP_000124693.1.12726 WP_000124693.1.12727 WP_000124693.1.12728 WP_000124693.1.12741 WP_000124693.1.12834 WP_000124693.1.12864 WP_000124693.1.12865 WP_000124693.1.12877 WP_000124693.1.12879 WP_000124693.1.12936 WP_000124693.1.1299 WP_000124693.1.12995 WP_000124693.1.1300 WP_000124693.1.13027 WP_000124693.1.13076 WP_000124693.1.13101 WP_000124693.1.13102 WP_000124693.1.13106 WP_000124693.1.13108 WP_000124693.1.13130 WP_000124693.1.13161 WP_000124693.1.13207 WP_000124693.1.1321 WP_000124693.1.13247 WP_000124693.1.1326 WP_000124693.1.13262 WP_000124693.1.13268 WP_000124693.1.13274 WP_000124693.1.13291 WP_000124693.1.133 WP_000124693.1.13311 WP_000124693.1.13314 WP_000124693.1.13334 WP_000124693.1.13338 WP_000124693.1.13342 WP_000124693.1.13352 WP_000124693.1.13367 WP_000124693.1.13391 WP_000124693.1.13406 WP_000124693.1.13414 WP_000124693.1.13429 WP_000124693.1.13440 WP_000124693.1.13443 WP_000124693.1.13446 WP_000124693.1.1346 WP_000124693.1.13465 WP_000124693.1.13476 WP_000124693.1.13488 WP_000124693.1.13509 WP_000124693.1.13528 WP_000124693.1.13543 WP_000124693.1.13573 WP_000124693.1.13599 WP_000124693.1.13602 WP_000124693.1.13625 WP_000124693.1.13661 WP_000124693.1.13669 WP_000124693.1.13677 WP_000124693.1.13686 WP_000124693.1.13691 WP_000124693.1.1372 WP_000124693.1.13732 WP_000124693.1.13741 WP_000124693.1.13750 WP_000124693.1.13764 WP_000124693.1.13799 WP_000124693.1.13819 WP_000124693.1.1382 WP_000124693.1.13827 WP_000124693.1.13829 WP_000124693.1.13848 WP_000124693.1.13857 WP_000124693.1.1387 WP_000124693.1.13908 WP_000124693.1.13932 WP_000124693.1.13967 WP_000124693.1.13968 WP_000124693.1.1397 WP_000124693.1.13972 WP_000124693.1.140 WP_000124693.1.14001 WP_000124693.1.1401 WP_000124693.1.14011 WP_000124693.1.14041 WP_000124693.1.14050 WP_000124693.1.14056 WP_000124693.1.1408 WP_000124693.1.14089 WP_000124693.1.14099 WP_000124693.1.14111 WP_000124693.1.1412 WP_000124693.1.14120 WP_000124693.1.14123 WP_000124693.1.14150 WP_000124693.1.14151 WP_000124693.1.14191 WP_000124693.1.14197 WP_000124693.1.14212 WP_000124693.1.14239 WP_000124693.1.14280 WP_000124693.1.14286 WP_000124693.1.14296 WP_000124693.1.14320 WP_000124693.1.14333 WP_000124693.1.14369 WP_000124693.1.14379 WP_000124693.1.14399 WP_000124693.1.1440 WP_000124693.1.14406 WP_000124693.1.14410 WP_000124693.1.14436 WP_000124693.1.14444 WP_000124693.1.14446 WP_000124693.1.14458 WP_000124693.1.14466 WP_000124693.1.14467 WP_000124693.1.14474 WP_000124693.1.14495 WP_000124693.1.14500 WP_000124693.1.14505 WP_000124693.1.14516 WP_000124693.1.14519 WP_000124693.1.14524 WP_000124693.1.14526 WP_000124693.1.14528 WP_000124693.1.14550 WP_000124693.1.14554 WP_000124693.1.14575 WP_000124693.1.146 WP_000124693.1.14618 WP_000124693.1.14688 WP_000124693.1.14701 WP_000124693.1.14703 WP_000124693.1.14706 WP_000124693.1.14708 WP_000124693.1.14719 WP_000124693.1.14725 WP_000124693.1.1473 WP_000124693.1.14737 WP_000124693.1.14765 WP_000124693.1.14789 WP_000124693.1.14793 WP_000124693.1.14808 WP_000124693.1.14810 WP_000124693.1.14819 WP_000124693.1.14852 WP_000124693.1.14876 WP_000124693.1.14877 WP_000124693.1.14884 WP_000124693.1.1489 WP_000124693.1.14894 WP_000124693.1.14913 WP_000124693.1.14917 WP_000124693.1.14927 WP_000124693.1.14930 WP_000124693.1.14932 WP_000124693.1.14936 WP_000124693.1.14947 WP_000124693.1.14948 WP_000124693.1.14964 WP_000124693.1.15011 WP_000124693.1.15046 WP_000124693.1.15054 WP_000124693.1.15055 WP_000124693.1.15059 WP_000124693.1.15067 WP_000124693.1.15079 WP_000124693.1.15100 WP_000124693.1.15102 WP_000124693.1.15124 WP_000124693.1.15184 WP_000124693.1.15214 WP_000124693.1.15223 WP_000124693.1.15226 WP_000124693.1.15244 WP_000124693.1.15265 WP_000124693.1.15276 WP_000124693.1.15316 WP_000124693.1.15318 WP_000124693.1.15353 WP_000124693.1.15362 WP_000124693.1.15369 WP_000124693.1.1540 WP_000124693.1.15415 WP_000124693.1.15423 WP_000124693.1.15433 WP_000124693.1.15439 WP_000124693.1.15468 WP_000124693.1.15479 WP_000124693.1.15483 WP_000124693.1.15487 WP_000124693.1.15508 WP_000124693.1.1551 WP_000124693.1.15535 WP_000124693.1.15581 WP_000124693.1.15585 WP_000124693.1.15586 WP_000124693.1.15597 WP_000124693.1.15612 WP_000124693.1.15616 WP_000124693.1.15625 WP_000124693.1.15627 WP_000124693.1.15637 WP_000124693.1.15644 WP_000124693.1.1568 WP_000124693.1.15708 WP_000124693.1.15710 WP_000124693.1.15717 WP_000124693.1.15775 WP_000124693.1.15777 WP_000124693.1.15784 WP_000124693.1.15795 WP_000124693.1.158 WP_000124693.1.15830 WP_000124693.1.15835 WP_000124693.1.15862 WP_000124693.1.15881 WP_000124693.1.15905 WP_000124693.1.15909 WP_000124693.1.15910 WP_000124693.1.15912 WP_000124693.1.1592 WP_000124693.1.15922 WP_000124693.1.15938 WP_000124693.1.15970 WP_000124693.1.15978 WP_000124693.1.15986 WP_000124693.1.15995 WP_000124693.1.16000 WP_000124693.1.16004 WP_000124693.1.16006 WP_000124693.1.1601 WP_000124693.1.16028 WP_000124693.1.16032 WP_000124693.1.16046 WP_000124693.1.16047 WP_000124693.1.16051 WP_000124693.1.16052 WP_000124693.1.16058 WP_000124693.1.16062 WP_000124693.1.16063 WP_000124693.1.16103 WP_000124693.1.1611 WP_000124693.1.16125 WP_000124693.1.16150 WP_000124693.1.16155 WP_000124693.1.16158 WP_000124693.1.16166 WP_000124693.1.16172 WP_000124693.1.16201 WP_000124693.1.16226 WP_000124693.1.16233 WP_000124693.1.16244 WP_000124693.1.1626 WP_000124693.1.16264 WP_000124693.1.16273 WP_000124693.1.16284 WP_000124693.1.16328 WP_000124693.1.16331 WP_000124693.1.16344 WP_000124693.1.1635 WP_000124693.1.16361 WP_000124693.1.16363 WP_000124693.1.16365 WP_000124693.1.16366 WP_000124693.1.16394 WP_000124693.1.16452 WP_000124693.1.16453 WP_000124693.1.16461 WP_000124693.1.16462 WP_000124693.1.16465 WP_000124693.1.16468 WP_000124693.1.16474 WP_000124693.1.16508 WP_000124693.1.16522 WP_000124693.1.16525 WP_000124693.1.16551 WP_000124693.1.16565 WP_000124693.1.16581 WP_000124693.1.16588 WP_000124693.1.16614 WP_000124693.1.16650 WP_000124693.1.16656 WP_000124693.1.16658 WP_000124693.1.16666 WP_000124693.1.16673 WP_000124693.1.1668 WP_000124693.1.16686 WP_000124693.1.16691 WP_000124693.1.167 WP_000124693.1.16710 WP_000124693.1.16729 WP_000124693.1.16732 WP_000124693.1.16735 WP_000124693.1.16736 WP_000124693.1.1674 WP_000124693.1.16767 WP_000124693.1.16781 WP_000124693.1.16786 WP_000124693.1.16804 WP_000124693.1.16817 WP_000124693.1.16819 WP_000124693.1.16826 WP_000124693.1.16846 WP_000124693.1.16855 WP_000124693.1.16858 WP_000124693.1.16873 WP_000124693.1.16879 WP_000124693.1.1689 WP_000124693.1.16893 WP_000124693.1.16896 WP_000124693.1.16903 WP_000124693.1.16905 WP_000124693.1.16910 WP_000124693.1.16916 WP_000124693.1.16941 WP_000124693.1.16942 WP_000124693.1.16944 WP_000124693.1.16948 WP_000124693.1.16965 WP_000124693.1.16972 WP_000124693.1.16998 WP_000124693.1.1700 WP_000124693.1.17031 WP_000124693.1.17049 WP_000124693.1.17058 WP_000124693.1.17060 WP_000124693.1.17078 WP_000124693.1.17093 WP_000124693.1.17096 WP_000124693.1.17098 WP_000124693.1.17105 WP_000124693.1.17188 WP_000124693.1.17202 WP_000124693.1.17219 WP_000124693.1.1722 WP_000124693.1.17270 WP_000124693.1.17285 WP_000124693.1.17302 WP_000124693.1.17307 WP_000124693.1.17308 WP_000124693.1.1733 WP_000124693.1.17368 WP_000124693.1.1737 WP_000124693.1.17390 WP_000124693.1.174 WP_000124693.1.17405 WP_000124693.1.17406 WP_000124693.1.17439 WP_000124693.1.17447 WP_000124693.1.17480 WP_000124693.1.17482 WP_000124693.1.1749 WP_000124693.1.17504 WP_000124693.1.17513 WP_000124693.1.17525 WP_000124693.1.17543 WP_000124693.1.17546 WP_000124693.1.17560 WP_000124693.1.17563 WP_000124693.1.1757 WP_000124693.1.17578 WP_000124693.1.17583 WP_000124693.1.17622 WP_000124693.1.17629 WP_000124693.1.17659 WP_000124693.1.17667 WP_000124693.1.17686 WP_000124693.1.17693 WP_000124693.1.17694 WP_000124693.1.17702 WP_000124693.1.17703 WP_000124693.1.17705 WP_000124693.1.17732 WP_000124693.1.17741 WP_000124693.1.17743 WP_000124693.1.17747 WP_000124693.1.17755 WP_000124693.1.17840 WP_000124693.1.17865 WP_000124693.1.17886 WP_000124693.1.17891 WP_000124693.1.17901 WP_000124693.1.17914 WP_000124693.1.17919 WP_000124693.1.17936 WP_000124693.1.17949 WP_000124693.1.17956 WP_000124693.1.1798 WP_000124693.1.17991 WP_000124693.1.18005 WP_000124693.1.1801 WP_000124693.1.18019 WP_000124693.1.18021 WP_000124693.1.18022 WP_000124693.1.18056 WP_000124693.1.18061 WP_000124693.1.1807 WP_000124693.1.18089 WP_000124693.1.18092 WP_000124693.1.18099 WP_000124693.1.18103 WP_000124693.1.18109 WP_000124693.1.18111 WP_000124693.1.18122 WP_000124693.1.18124 WP_000124693.1.1814 WP_000124693.1.18144 WP_000124693.1.18149 WP_000124693.1.18163 WP_000124693.1.18173 WP_000124693.1.18177 WP_000124693.1.18178 WP_000124693.1.1818 WP_000124693.1.18192 WP_000124693.1.18249 WP_000124693.1.1825 WP_000124693.1.18254 WP_000124693.1.18265 WP_000124693.1.18267 WP_000124693.1.18270 WP_000124693.1.18277 WP_000124693.1.18280 WP_000124693.1.18281 WP_000124693.1.18282 WP_000124693.1.1832 WP_000124693.1.18328 WP_000124693.1.18355 WP_000124693.1.18358 WP_000124693.1.18365 WP_000124693.1.18370 WP_000124693.1.18384 WP_000124693.1.18406 WP_000124693.1.18426 WP_000124693.1.18441 WP_000124693.1.18445 WP_000124693.1.18468 WP_000124693.1.18474 WP_000124693.1.18485 WP_000124693.1.18489 WP_000124693.1.18513 WP_000124693.1.18607 WP_000124693.1.18610 WP_000124693.1.18641 WP_000124693.1.18678 WP_000124693.1.18686 WP_000124693.1.18692 WP_000124693.1.18705 WP_000124693.1.18715 WP_000124693.1.18722 WP_000124693.1.18737 WP_000124693.1.18766 WP_000124693.1.18776 WP_000124693.1.18796 WP_000124693.1.1880 WP_000124693.1.18822 WP_000124693.1.18847 WP_000124693.1.1885 WP_000124693.1.18860 WP_000124693.1.18881 WP_000124693.1.18886 WP_000124693.1.18895 WP_000124693.1.18919 WP_000124693.1.18922 WP_000124693.1.18940 WP_000124693.1.18949 WP_000124693.1.1895 WP_000124693.1.18959 WP_000124693.1.1897 WP_000124693.1.18972 WP_000124693.1.19001 WP_000124693.1.19006 WP_000124693.1.19030 WP_000124693.1.19038 WP_000124693.1.19044 WP_000124693.1.19053 WP_000124693.1.19055 WP_000124693.1.19064 WP_000124693.1.19084 WP_000124693.1.19093 WP_000124693.1.19163 WP_000124693.1.19174 WP_000124693.1.19187 WP_000124693.1.19228 WP_000124693.1.19240 WP_000124693.1.19273 WP_000124693.1.19288 WP_000124693.1.19291 WP_000124693.1.19300 WP_000124693.1.19320 WP_000124693.1.19340 WP_000124693.1.19357 WP_000124693.1.19373 WP_000124693.1.1939 WP_000124693.1.19405 WP_000124693.1.19422 WP_000124693.1.19433 WP_000124693.1.19454 WP_000124693.1.19456 WP_000124693.1.19458 WP_000124693.1.19460 WP_000124693.1.19461 WP_000124693.1.19469 WP_000124693.1.19496 WP_000124693.1.19535 WP_000124693.1.19538 WP_000124693.1.1954 WP_000124693.1.1955 WP_000124693.1.19588 WP_000124693.1.19589 WP_000124693.1.19614 WP_000124693.1.19616 WP_000124693.1.19642 WP_000124693.1.19656 WP_000124693.1.19660 WP_000124693.1.19663 WP_000124693.1.1968 WP_000124693.1.19683 WP_000124693.1.19686 WP_000124693.1.19702 WP_000124693.1.19723 WP_000124693.1.19724 WP_000124693.1.19731 WP_000124693.1.19740 WP_000124693.1.19749 WP_000124693.1.19784 WP_000124693.1.19793 WP_000124693.1.19794 WP_000124693.1.19802 WP_000124693.1.19809 WP_000124693.1.19823 WP_000124693.1.19834 WP_000124693.1.19851 WP_000124693.1.19863 WP_000124693.1.19867 WP_000124693.1.19882 WP_000124693.1.19884 WP_000124693.1.1990 WP_000124693.1.1992 WP_000124693.1.19938 WP_000124693.1.19967 WP_000124693.1.19970 WP_000124693.1.19975 WP_000124693.1.1998 WP_000124693.1.19987 WP_000124693.1.19999 WP_000124693.1.20 WP_000124693.1.20023 WP_000124693.1.20034 WP_000124693.1.20081 WP_000124693.1.20086 WP_000124693.1.20089 WP_000124693.1.20091 WP_000124693.1.2010 WP_000124693.1.20119 WP_000124693.1.20212 WP_000124693.1.20218 WP_000124693.1.20254 WP_000124693.1.20255 WP_000124693.1.2026 WP_000124693.1.20261 WP_000124693.1.20266 WP_000124693.1.20271 WP_000124693.1.20296 WP_000124693.1.20330 WP_000124693.1.20339 WP_000124693.1.20349 WP_000124693.1.2036 WP_000124693.1.20362 WP_000124693.1.20364 WP_000124693.1.20376 WP_000124693.1.20391 WP_000124693.1.2041 WP_000124693.1.20415 WP_000124693.1.20418 WP_000124693.1.20419 WP_000124693.1.20425 WP_000124693.1.20437 WP_000124693.1.20438 WP_000124693.1.20443 WP_000124693.1.20446 WP_000124693.1.20465 WP_000124693.1.2047 WP_000124693.1.20488 WP_000124693.1.20492 WP_000124693.1.20503 WP_000124693.1.20525 WP_000124693.1.2053 WP_000124693.1.2054 WP_000124693.1.20553 WP_000124693.1.20564 WP_000124693.1.20573 WP_000124693.1.20614 WP_000124693.1.20626 WP_000124693.1.20631 WP_000124693.1.20635 WP_000124693.1.20646 WP_000124693.1.20695 WP_000124693.1.20700 WP_000124693.1.20718 WP_000124693.1.20721 WP_000124693.1.2073 WP_000124693.1.20740 WP_000124693.1.20760 WP_000124693.1.20767 WP_000124693.1.20787 WP_000124693.1.20789 WP_000124693.1.20795 WP_000124693.1.20810 WP_000124693.1.20828 WP_000124693.1.20839 WP_000124693.1.20862 WP_000124693.1.2087 WP_000124693.1.20883 WP_000124693.1.20886 WP_000124693.1.20894 WP_000124693.1.20900 WP_000124693.1.20908 WP_000124693.1.2091 WP_000124693.1.20947 WP_000124693.1.20953 WP_000124693.1.2101 WP_000124693.1.21010 WP_000124693.1.21049 WP_000124693.1.2106 WP_000124693.1.21062 WP_000124693.1.2107 WP_000124693.1.21075 WP_000124693.1.21079 WP_000124693.1.21086 WP_000124693.1.21089 WP_000124693.1.21103 WP_000124693.1.21136 WP_000124693.1.21144 WP_000124693.1.21146 WP_000124693.1.2116 WP_000124693.1.21162 WP_000124693.1.21165 WP_000124693.1.21181 WP_000124693.1.21184 WP_000124693.1.21185 WP_000124693.1.21194 WP_000124693.1.21202 WP_000124693.1.21241 WP_000124693.1.21245 WP_000124693.1.21246 WP_000124693.1.21260 WP_000124693.1.21269 WP_000124693.1.21286 WP_000124693.1.2130 WP_000124693.1.21309 WP_000124693.1.21326 WP_000124693.1.21332 WP_000124693.1.21351 WP_000124693.1.21362 WP_000124693.1.21366 WP_000124693.1.2139 WP_000124693.1.21399 WP_000124693.1.21400 WP_000124693.1.21404 WP_000124693.1.21423 WP_000124693.1.21443 WP_000124693.1.21453 WP_000124693.1.2146 WP_000124693.1.21473 WP_000124693.1.21492 WP_000124693.1.21497 WP_000124693.1.21499 WP_000124693.1.21534 WP_000124693.1.21548 WP_000124693.1.2155 WP_000124693.1.21603 WP_000124693.1.21616 WP_000124693.1.2166 WP_000124693.1.21674 WP_000124693.1.21681 WP_000124693.1.21692 WP_000124693.1.21715 WP_000124693.1.21728 WP_000124693.1.21730 WP_000124693.1.21750 WP_000124693.1.21751 WP_000124693.1.21757 WP_000124693.1.21792 WP_000124693.1.21825 WP_000124693.1.21877 WP_000124693.1.21886 WP_000124693.1.21909 WP_000124693.1.21910 WP_000124693.1.21940 WP_000124693.1.21946 WP_000124693.1.21950 WP_000124693.1.21966 WP_000124693.1.21981 WP_000124693.1.21991 WP_000124693.1.22019 WP_000124693.1.22024 WP_000124693.1.22026 WP_000124693.1.22030 WP_000124693.1.2205 WP_000124693.1.22051 WP_000124693.1.22062 WP_000124693.1.22064 WP_000124693.1.22067 WP_000124693.1.22069 WP_000124693.1.22096 WP_000124693.1.22117 WP_000124693.1.22118 WP_000124693.1.22126 WP_000124693.1.22136 WP_000124693.1.22158 WP_000124693.1.2216 WP_000124693.1.22162 WP_000124693.1.22169 WP_000124693.1.22205 WP_000124693.1.22208 WP_000124693.1.2221 WP_000124693.1.22235 WP_000124693.1.2224 WP_000124693.1.22240 WP_000124693.1.2227 WP_000124693.1.22270 WP_000124693.1.22296 WP_000124693.1.22315 WP_000124693.1.22323 WP_000124693.1.22337 WP_000124693.1.22346 WP_000124693.1.2235 WP_000124693.1.22373 WP_000124693.1.22379 WP_000124693.1.22388 WP_000124693.1.22427 WP_000124693.1.22449 WP_000124693.1.22451 WP_000124693.1.22453 WP_000124693.1.22454 WP_000124693.1.2246 WP_000124693.1.22460 WP_000124693.1.22476 WP_000124693.1.22485 WP_000124693.1.22514 WP_000124693.1.22537 WP_000124693.1.22565 WP_000124693.1.22566 WP_000124693.1.22575 WP_000124693.1.22582 WP_000124693.1.22590 WP_000124693.1.22595 WP_000124693.1.22604 WP_000124693.1.22605 WP_000124693.1.22614 WP_000124693.1.22620 WP_000124693.1.22623 WP_000124693.1.22652 WP_000124693.1.22676 WP_000124693.1.22683 WP_000124693.1.22692 WP_000124693.1.22758 WP_000124693.1.22760 WP_000124693.1.2283 WP_000124693.1.2284 WP_000124693.1.22845 WP_000124693.1.22855 WP_000124693.1.22857 WP_000124693.1.22864 WP_000124693.1.22870 WP_000124693.1.22880 WP_000124693.1.22895 WP_000124693.1.22902 WP_000124693.1.22926 WP_000124693.1.22943 WP_000124693.1.22947 WP_000124693.1.22966 WP_000124693.1.22967 WP_000124693.1.22979 WP_000124693.1.23010 WP_000124693.1.23040 WP_000124693.1.23053 WP_000124693.1.23058 WP_000124693.1.23080 WP_000124693.1.23102 WP_000124693.1.23114 WP_000124693.1.2314 WP_000124693.1.23148 WP_000124693.1.23155 WP_000124693.1.23169 WP_000124693.1.23172 WP_000124693.1.23175 WP_000124693.1.23192 WP_000124693.1.23201 WP_000124693.1.23218 WP_000124693.1.2324 WP_000124693.1.23246 WP_000124693.1.23258 WP_000124693.1.23259 WP_000124693.1.23274 WP_000124693.1.23279 WP_000124693.1.23309 WP_000124693.1.2331 WP_000124693.1.23311 WP_000124693.1.2332 WP_000124693.1.23329 WP_000124693.1.23340 WP_000124693.1.23343 WP_000124693.1.2336 WP_000124693.1.23365 WP_000124693.1.23379 WP_000124693.1.23409 WP_000124693.1.23412 WP_000124693.1.2342 WP_000124693.1.23426 WP_000124693.1.23442 WP_000124693.1.23444 WP_000124693.1.23460 WP_000124693.1.23466 WP_000124693.1.23472 WP_000124693.1.23482 WP_000124693.1.23485 WP_000124693.1.23492 WP_000124693.1.235 WP_000124693.1.23500 WP_000124693.1.23509 WP_000124693.1.23513 WP_000124693.1.23515 WP_000124693.1.23529 WP_000124693.1.23548 WP_000124693.1.23571 WP_000124693.1.2358 WP_000124693.1.23587 WP_000124693.1.23604 WP_000124693.1.23621 WP_000124693.1.23629 WP_000124693.1.23631 WP_000124693.1.23634 WP_000124693.1.23639 WP_000124693.1.2364 WP_000124693.1.23643 WP_000124693.1.23646 WP_000124693.1.23670 WP_000124693.1.23675 WP_000124693.1.23679 WP_000124693.1.23685 WP_000124693.1.237 WP_000124693.1.23707 WP_000124693.1.23720 WP_000124693.1.23728 WP_000124693.1.23736 WP_000124693.1.23746 WP_000124693.1.2375 WP_000124693.1.23755 WP_000124693.1.2376 WP_000124693.1.23783 WP_000124693.1.23786 WP_000124693.1.23787 WP_000124693.1.2380 WP_000124693.1.23801 WP_000124693.1.23819 WP_000124693.1.23932 WP_000124693.1.23959 WP_000124693.1.24017 WP_000124693.1.24028 WP_000124693.1.24061 WP_000124693.1.24082 WP_000124693.1.24083 WP_000124693.1.24117 WP_000124693.1.24125 WP_000124693.1.24138 WP_000124693.1.24145 WP_000124693.1.2415 WP_000124693.1.24153 WP_000124693.1.24158 WP_000124693.1.24163 WP_000124693.1.24206 WP_000124693.1.24214 WP_000124693.1.24250 WP_000124693.1.24259 WP_000124693.1.24291 WP_000124693.1.24297 WP_000124693.1.24303 WP_000124693.1.24308 WP_000124693.1.24322 WP_000124693.1.24325 WP_000124693.1.24355 WP_000124693.1.24361 WP_000124693.1.24375 WP_000124693.1.24376 WP_000124693.1.24392 WP_000124693.1.24394 WP_000124693.1.24400 WP_000124693.1.24408 WP_000124693.1.24409 WP_000124693.1.24412 WP_000124693.1.24419 WP_000124693.1.24420 WP_000124693.1.24433 WP_000124693.1.24444 WP_000124693.1.24450 WP_000124693.1.24476 WP_000124693.1.24494 WP_000124693.1.24521 WP_000124693.1.24555 WP_000124693.1.24567 WP_000124693.1.24578 WP_000124693.1.24619 WP_000124693.1.24643 WP_000124693.1.2467 WP_000124693.1.24673 WP_000124693.1.24686 WP_000124693.1.24688 WP_000124693.1.24689 WP_000124693.1.24696 WP_000124693.1.24716 WP_000124693.1.24723 WP_000124693.1.24727 WP_000124693.1.24737 WP_000124693.1.24779 WP_000124693.1.24803 WP_000124693.1.2481 WP_000124693.1.24832 WP_000124693.1.24837 WP_000124693.1.24839 WP_000124693.1.24873 WP_000124693.1.24901 WP_000124693.1.24944 WP_000124693.1.24964 WP_000124693.1.24995 WP_000124693.1.25008 WP_000124693.1.25015 WP_000124693.1.25017 WP_000124693.1.25032 WP_000124693.1.25036 WP_000124693.1.25041 WP_000124693.1.25053 WP_000124693.1.25064 WP_000124693.1.25072 WP_000124693.1.25119 WP_000124693.1.25130 WP_000124693.1.25140 WP_000124693.1.25159 WP_000124693.1.25175 WP_000124693.1.25185 WP_000124693.1.25196 WP_000124693.1.25205 WP_000124693.1.25206 WP_000124693.1.25210 WP_000124693.1.25217 WP_000124693.1.25219 WP_000124693.1.25229 WP_000124693.1.2525 WP_000124693.1.25297 WP_000124693.1.25304 WP_000124693.1.25354 WP_000124693.1.25374 WP_000124693.1.25397 WP_000124693.1.25405 WP_000124693.1.25421 WP_000124693.1.25426 WP_000124693.1.25454 WP_000124693.1.25475 WP_000124693.1.25490 WP_000124693.1.25493 WP_000124693.1.25498 WP_000124693.1.25508 WP_000124693.1.25512 WP_000124693.1.25514 WP_000124693.1.2554 WP_000124693.1.25546 WP_000124693.1.25564 WP_000124693.1.25596 WP_000124693.1.25603 WP_000124693.1.25618 WP_000124693.1.2562 WP_000124693.1.25666 WP_000124693.1.25668 WP_000124693.1.2568 WP_000124693.1.25690 WP_000124693.1.2570 WP_000124693.1.25700 WP_000124693.1.25703 WP_000124693.1.25708 WP_000124693.1.25709 WP_000124693.1.25722 WP_000124693.1.25740 WP_000124693.1.25780 WP_000124693.1.25793 WP_000124693.1.25807 WP_000124693.1.25809 WP_000124693.1.2581 WP_000124693.1.25814 WP_000124693.1.25821 WP_000124693.1.25825 WP_000124693.1.25833 WP_000124693.1.25835 WP_000124693.1.25846 WP_000124693.1.25882 WP_000124693.1.25911 WP_000124693.1.25928 WP_000124693.1.25932 WP_000124693.1.25944 WP_000124693.1.25951 WP_000124693.1.25962 WP_000124693.1.25963 WP_000124693.1.25988 WP_000124693.1.26001 WP_000124693.1.26027 WP_000124693.1.26030 WP_000124693.1.26034 WP_000124693.1.26075 WP_000124693.1.26083 WP_000124693.1.26093 WP_000124693.1.26107 WP_000124693.1.26122 WP_000124693.1.26123 WP_000124693.1.26129 WP_000124693.1.2615 WP_000124693.1.26194 WP_000124693.1.26199 WP_000124693.1.26213 WP_000124693.1.26217 WP_000124693.1.26224 WP_000124693.1.26230 WP_000124693.1.26232 WP_000124693.1.26269 WP_000124693.1.26272 WP_000124693.1.26282 WP_000124693.1.26286 WP_000124693.1.26288 WP_000124693.1.26311 WP_000124693.1.26319 WP_000124693.1.2634 WP_000124693.1.26363 WP_000124693.1.26384 WP_000124693.1.26394 WP_000124693.1.26414 WP_000124693.1.26426 WP_000124693.1.26429 WP_000124693.1.26440 WP_000124693.1.26441 WP_000124693.1.26491 WP_000124693.1.26493 WP_000124693.1.26512 WP_000124693.1.26532 WP_000124693.1.2654 WP_000124693.1.26551 WP_000124693.1.26554 WP_000124693.1.26563 WP_000124693.1.26567 WP_000124693.1.26576 WP_000124693.1.26582 WP_000124693.1.26587 WP_000124693.1.2660 WP_000124693.1.26636 WP_000124693.1.26646 WP_000124693.1.2667 WP_000124693.1.26687 WP_000124693.1.26689 WP_000124693.1.26709 WP_000124693.1.2672 WP_000124693.1.26741 WP_000124693.1.26750 WP_000124693.1.26758 WP_000124693.1.26787 WP_000124693.1.2679 WP_000124693.1.26794 WP_000124693.1.26833 WP_000124693.1.26856 WP_000124693.1.26882 WP_000124693.1.26883 WP_000124693.1.26892 WP_000124693.1.26908 WP_000124693.1.26919 WP_000124693.1.2692 WP_000124693.1.26924 WP_000124693.1.26928 WP_000124693.1.26936 WP_000124693.1.26980 WP_000124693.1.270 WP_000124693.1.27008 WP_000124693.1.27010 WP_000124693.1.27027 WP_000124693.1.27051 WP_000124693.1.27055 WP_000124693.1.27070 WP_000124693.1.27072 WP_000124693.1.27077 WP_000124693.1.27084 WP_000124693.1.27086 WP_000124693.1.27087 WP_000124693.1.27111 WP_000124693.1.27115 WP_000124693.1.27122 WP_000124693.1.27123 WP_000124693.1.2713 WP_000124693.1.27169 WP_000124693.1.2717 WP_000124693.1.27173 WP_000124693.1.272 WP_000124693.1.27206 WP_000124693.1.27223 WP_000124693.1.27228 WP_000124693.1.2723 WP_000124693.1.27255 WP_000124693.1.27272 WP_000124693.1.27279 WP_000124693.1.27282 WP_000124693.1.27285 WP_000124693.1.27309 WP_000124693.1.27314 WP_000124693.1.27329 WP_000124693.1.27361 WP_000124693.1.27383 WP_000124693.1.27419 WP_000124693.1.27423 WP_000124693.1.27452 WP_000124693.1.27513 WP_000124693.1.27522 WP_000124693.1.27523 WP_000124693.1.27535 WP_000124693.1.27544 WP_000124693.1.27547 WP_000124693.1.27556 WP_000124693.1.27561 WP_000124693.1.27565 WP_000124693.1.27595 WP_000124693.1.27598 WP_000124693.1.27616 WP_000124693.1.2763 WP_000124693.1.27632 WP_000124693.1.27638 WP_000124693.1.27655 WP_000124693.1.27658 WP_000124693.1.27665 WP_000124693.1.27679 WP_000124693.1.27706 WP_000124693.1.27707 WP_000124693.1.27713 WP_000124693.1.27755 WP_000124693.1.27761 WP_000124693.1.2777 WP_000124693.1.27775 WP_000124693.1.27776 WP_000124693.1.27785 WP_000124693.1.27798 WP_000124693.1.27800 WP_000124693.1.27815 WP_000124693.1.27833 WP_000124693.1.27857 WP_000124693.1.27883 WP_000124693.1.27900 WP_000124693.1.27928 WP_000124693.1.27945 WP_000124693.1.27969 WP_000124693.1.27977 WP_000124693.1.27995 WP_000124693.1.27997 WP_000124693.1.28002 WP_000124693.1.28004 WP_000124693.1.28032 WP_000124693.1.28037 WP_000124693.1.28056 WP_000124693.1.2806 WP_000124693.1.28073 WP_000124693.1.2809 WP_000124693.1.28094 WP_000124693.1.28116 WP_000124693.1.28126 WP_000124693.1.28139 WP_000124693.1.28155 WP_000124693.1.28170 WP_000124693.1.28174 WP_000124693.1.28198 WP_000124693.1.28200 WP_000124693.1.2822 WP_000124693.1.28225 WP_000124693.1.28229 WP_000124693.1.28232 WP_000124693.1.28233 WP_000124693.1.28235 WP_000124693.1.2825 WP_000124693.1.28267 WP_000124693.1.2829 WP_000124693.1.28301 WP_000124693.1.28302 WP_000124693.1.28303 WP_000124693.1.2835 WP_000124693.1.28370 WP_000124693.1.28384 WP_000124693.1.28386 WP_000124693.1.28393 WP_000124693.1.28395 WP_000124693.1.284 WP_000124693.1.2845 WP_000124693.1.28462 WP_000124693.1.28479 WP_000124693.1.28504 WP_000124693.1.28514 WP_000124693.1.2853 WP_000124693.1.28538 WP_000124693.1.28570 WP_000124693.1.28575 WP_000124693.1.28612 WP_000124693.1.28620 WP_000124693.1.28625 WP_000124693.1.28627 WP_000124693.1.28655 WP_000124693.1.28673 WP_000124693.1.28692 WP_000124693.1.28694 WP_000124693.1.287 WP_000124693.1.2873 WP_000124693.1.28733 WP_000124693.1.28773 WP_000124693.1.28775 WP_000124693.1.28776 WP_000124693.1.2879 WP_000124693.1.28811 WP_000124693.1.2890 WP_000124693.1.28902 WP_000124693.1.28917 WP_000124693.1.28921 WP_000124693.1.28938 WP_000124693.1.28946 WP_000124693.1.28948 WP_000124693.1.28962 WP_000124693.1.28963 WP_000124693.1.28977 WP_000124693.1.29006 WP_000124693.1.29010 WP_000124693.1.29023 WP_000124693.1.29042 WP_000124693.1.2905 WP_000124693.1.2907 WP_000124693.1.29081 WP_000124693.1.29089 WP_000124693.1.29099 WP_000124693.1.2910 WP_000124693.1.29113 WP_000124693.1.29130 WP_000124693.1.2915 WP_000124693.1.29153 WP_000124693.1.29168 WP_000124693.1.29174 WP_000124693.1.29190 WP_000124693.1.29203 WP_000124693.1.29218 WP_000124693.1.29237 WP_000124693.1.2924 WP_000124693.1.29248 WP_000124693.1.29255 WP_000124693.1.29265 WP_000124693.1.29274 WP_000124693.1.29288 WP_000124693.1.2932 WP_000124693.1.29349 WP_000124693.1.29389 WP_000124693.1.29422 WP_000124693.1.29436 WP_000124693.1.29439 WP_000124693.1.29454 WP_000124693.1.2946 WP_000124693.1.29462 WP_000124693.1.29509 WP_000124693.1.29530 WP_000124693.1.29563 WP_000124693.1.29576 WP_000124693.1.29588 WP_000124693.1.29593 WP_000124693.1.29601 WP_000124693.1.29606 WP_000124693.1.29615 WP_000124693.1.29619 WP_000124693.1.29682 WP_000124693.1.29704 WP_000124693.1.29711 WP_000124693.1.29727 WP_000124693.1.29732 WP_000124693.1.2974 WP_000124693.1.29743 WP_000124693.1.29768 WP_000124693.1.29774 WP_000124693.1.29775 WP_000124693.1.29782 WP_000124693.1.29827 WP_000124693.1.29833 WP_000124693.1.2984 WP_000124693.1.29845 WP_000124693.1.29851 WP_000124693.1.29865 WP_000124693.1.29886 WP_000124693.1.29898 WP_000124693.1.29919 WP_000124693.1.29923 WP_000124693.1.29924 WP_000124693.1.2994 WP_000124693.1.29964 WP_000124693.1.29969 WP_000124693.1.29983 WP_000124693.1.29990 WP_000124693.1.30006 WP_000124693.1.30009 WP_000124693.1.30013 WP_000124693.1.30018 WP_000124693.1.3002 WP_000124693.1.30022 WP_000124693.1.30027 WP_000124693.1.30034 WP_000124693.1.30049 WP_000124693.1.3005 WP_000124693.1.30058 WP_000124693.1.30059 WP_000124693.1.30086 WP_000124693.1.30093 WP_000124693.1.30165 WP_000124693.1.3017 WP_000124693.1.30170 WP_000124693.1.30172 WP_000124693.1.30179 WP_000124693.1.30180 WP_000124693.1.30185 WP_000124693.1.30195 WP_000124693.1.30202 WP_000124693.1.30210 WP_000124693.1.30213 WP_000124693.1.30225 WP_000124693.1.30238 WP_000124693.1.30246 WP_000124693.1.30278 WP_000124693.1.30331 WP_000124693.1.30354 WP_000124693.1.30356 WP_000124693.1.30357 WP_000124693.1.30362 WP_000124693.1.30386 WP_000124693.1.30389 WP_000124693.1.3042 WP_000124693.1.30421 WP_000124693.1.30425 WP_000124693.1.30437 WP_000124693.1.30440 WP_000124693.1.30448 WP_000124693.1.30469 WP_000124693.1.30489 WP_000124693.1.30492 WP_000124693.1.30505 WP_000124693.1.30507 WP_000124693.1.30517 WP_000124693.1.30535 WP_000124693.1.30542 WP_000124693.1.30544 WP_000124693.1.30547 WP_000124693.1.30548 WP_000124693.1.30555 WP_000124693.1.30556 WP_000124693.1.30572 WP_000124693.1.30573 WP_000124693.1.30585 WP_000124693.1.30589 WP_000124693.1.30602 WP_000124693.1.30618 WP_000124693.1.30619 WP_000124693.1.30627 WP_000124693.1.30635 WP_000124693.1.3066 WP_000124693.1.30664 WP_000124693.1.3067 WP_000124693.1.3068 WP_000124693.1.30688 WP_000124693.1.30696 WP_000124693.1.30752 WP_000124693.1.30794 WP_000124693.1.3080 WP_000124693.1.30802 WP_000124693.1.30803 WP_000124693.1.30806 WP_000124693.1.30819 WP_000124693.1.30823 WP_000124693.1.30833 WP_000124693.1.30835 WP_000124693.1.3089 WP_000124693.1.30909 WP_000124693.1.30934 WP_000124693.1.3095 WP_000124693.1.30951 WP_000124693.1.30967 WP_000124693.1.30968 WP_000124693.1.30972 WP_000124693.1.31 WP_000124693.1.31001 WP_000124693.1.31011 WP_000124693.1.31042 WP_000124693.1.31046 WP_000124693.1.31066 WP_000124693.1.31069 WP_000124693.1.31078 WP_000124693.1.31086 WP_000124693.1.31092 WP_000124693.1.31107 WP_000124693.1.31111 WP_000124693.1.31122 WP_000124693.1.3113 WP_000124693.1.31139 WP_000124693.1.3114 WP_000124693.1.31145 WP_000124693.1.31155 WP_000124693.1.31156 WP_000124693.1.31167 WP_000124693.1.31171 WP_000124693.1.31182 WP_000124693.1.31185 WP_000124693.1.3119 WP_000124693.1.31190 WP_000124693.1.31195 WP_000124693.1.31196 WP_000124693.1.31198 WP_000124693.1.31205 WP_000124693.1.3121 WP_000124693.1.31210 WP_000124693.1.31214 WP_000124693.1.31219 WP_000124693.1.31222 WP_000124693.1.31223 WP_000124693.1.3124 WP_000124693.1.31251 WP_000124693.1.31262 WP_000124693.1.31272 WP_000124693.1.31281 WP_000124693.1.31303 WP_000124693.1.3131 WP_000124693.1.31335 WP_000124693.1.31352 WP_000124693.1.31362 WP_000124693.1.31389 WP_000124693.1.31413 WP_000124693.1.31435 WP_000124693.1.31446 WP_000124693.1.31451 WP_000124693.1.31476 WP_000124693.1.31504 WP_000124693.1.31515 WP_000124693.1.31533 WP_000124693.1.31546 WP_000124693.1.31578 WP_000124693.1.31585 WP_000124693.1.31658 WP_000124693.1.31665 WP_000124693.1.3167 WP_000124693.1.3170 WP_000124693.1.31725 WP_000124693.1.31762 WP_000124693.1.31782 WP_000124693.1.31799 WP_000124693.1.31836 WP_000124693.1.31845 WP_000124693.1.3185 WP_000124693.1.31854 WP_000124693.1.31895 WP_000124693.1.31901 WP_000124693.1.31927 WP_000124693.1.31940 WP_000124693.1.31951 WP_000124693.1.31952 WP_000124693.1.31967 WP_000124693.1.31972 WP_000124693.1.31983 WP_000124693.1.32006 WP_000124693.1.32038 WP_000124693.1.32041 WP_000124693.1.32042 WP_000124693.1.32054 WP_000124693.1.32056 WP_000124693.1.3207 WP_000124693.1.3208 WP_000124693.1.32109 WP_000124693.1.32116 WP_000124693.1.32170 WP_000124693.1.32189 WP_000124693.1.32192 WP_000124693.1.32202 WP_000124693.1.32204 WP_000124693.1.32206 WP_000124693.1.32252 WP_000124693.1.32255 WP_000124693.1.32260 WP_000124693.1.32263 WP_000124693.1.32274 WP_000124693.1.32275 WP_000124693.1.32277 WP_000124693.1.32293 WP_000124693.1.32299 WP_000124693.1.32309 WP_000124693.1.32357 WP_000124693.1.32368 WP_000124693.1.32408 WP_000124693.1.32422 WP_000124693.1.32424 WP_000124693.1.32425 WP_000124693.1.32434 WP_000124693.1.32438 WP_000124693.1.32458 WP_000124693.1.32459 WP_000124693.1.32460 WP_000124693.1.32491 WP_000124693.1.32493 WP_000124693.1.32515 WP_000124693.1.32519 WP_000124693.1.32527 WP_000124693.1.32529 WP_000124693.1.32545 WP_000124693.1.32563 WP_000124693.1.32578 WP_000124693.1.32617 WP_000124693.1.32624 WP_000124693.1.32629 WP_000124693.1.32643 WP_000124693.1.32660 WP_000124693.1.32668 WP_000124693.1.3270 WP_000124693.1.32702 WP_000124693.1.32714 WP_000124693.1.32725 WP_000124693.1.32740 WP_000124693.1.32747 WP_000124693.1.32750 WP_000124693.1.3278 WP_000124693.1.32786 WP_000124693.1.32804 WP_000124693.1.32832 WP_000124693.1.32838 WP_000124693.1.32848 WP_000124693.1.32860 WP_000124693.1.32868 WP_000124693.1.32881 WP_000124693.1.32899 WP_000124693.1.329 WP_000124693.1.3290 WP_000124693.1.32900 WP_000124693.1.32902 WP_000124693.1.32907 WP_000124693.1.32930 WP_000124693.1.32940 WP_000124693.1.32941 WP_000124693.1.3296 WP_000124693.1.32961 WP_000124693.1.32966 WP_000124693.1.32977 WP_000124693.1.32985 WP_000124693.1.33010 WP_000124693.1.33030 WP_000124693.1.33037 WP_000124693.1.3304 WP_000124693.1.3305 WP_000124693.1.33051 WP_000124693.1.33065 WP_000124693.1.33078 WP_000124693.1.3310 WP_000124693.1.33106 WP_000124693.1.33114 WP_000124693.1.33122 WP_000124693.1.33127 WP_000124693.1.33143 WP_000124693.1.33144 WP_000124693.1.3315 WP_000124693.1.33160 WP_000124693.1.33208 WP_000124693.1.33214 WP_000124693.1.33247 WP_000124693.1.33248 WP_000124693.1.33253 WP_000124693.1.33261 WP_000124693.1.33270 WP_000124693.1.33280 WP_000124693.1.33283 WP_000124693.1.333 WP_000124693.1.33313 WP_000124693.1.33339 WP_000124693.1.33382 WP_000124693.1.33392 WP_000124693.1.33409 WP_000124693.1.33420 WP_000124693.1.33486 WP_000124693.1.33490 WP_000124693.1.33492 WP_000124693.1.33499 WP_000124693.1.335 WP_000124693.1.33501 WP_000124693.1.33504 WP_000124693.1.33529 WP_000124693.1.33553 WP_000124693.1.3356 WP_000124693.1.33580 WP_000124693.1.33586 WP_000124693.1.33592 WP_000124693.1.33609 WP_000124693.1.33629 WP_000124693.1.3364 WP_000124693.1.33659 WP_000124693.1.33689 WP_000124693.1.33693 WP_000124693.1.3370 WP_000124693.1.33730 WP_000124693.1.33741 WP_000124693.1.33817 WP_000124693.1.33825 WP_000124693.1.33840 WP_000124693.1.33865 WP_000124693.1.33894 WP_000124693.1.3392 WP_000124693.1.33926 WP_000124693.1.3394 WP_000124693.1.3395 WP_000124693.1.33957 WP_000124693.1.3396 WP_000124693.1.33969 WP_000124693.1.33986 WP_000124693.1.34 WP_000124693.1.34001 WP_000124693.1.34022 WP_000124693.1.34043 WP_000124693.1.34059 WP_000124693.1.34075 WP_000124693.1.34081 WP_000124693.1.34084 WP_000124693.1.34091 WP_000124693.1.34107 WP_000124693.1.34118 WP_000124693.1.34126 WP_000124693.1.34179 WP_000124693.1.34184 WP_000124693.1.34185 WP_000124693.1.34211 WP_000124693.1.34214 WP_000124693.1.34234 WP_000124693.1.34257 WP_000124693.1.34259 WP_000124693.1.34279 WP_000124693.1.34284 WP_000124693.1.34292 WP_000124693.1.34304 WP_000124693.1.34319 WP_000124693.1.34330 WP_000124693.1.34376 WP_000124693.1.3438 WP_000124693.1.34382 WP_000124693.1.34417 WP_000124693.1.34424 WP_000124693.1.34431 WP_000124693.1.3445 WP_000124693.1.34453 WP_000124693.1.34454 WP_000124693.1.34458 WP_000124693.1.34484 WP_000124693.1.34496 WP_000124693.1.34517 WP_000124693.1.34530 WP_000124693.1.34610 WP_000124693.1.34614 WP_000124693.1.34647 WP_000124693.1.34659 WP_000124693.1.34665 WP_000124693.1.34667 WP_000124693.1.34684 WP_000124693.1.34694 WP_000124693.1.34703 WP_000124693.1.34704 WP_000124693.1.34707 WP_000124693.1.34711 WP_000124693.1.34745 WP_000124693.1.34751 WP_000124693.1.3476 WP_000124693.1.34801 WP_000124693.1.34808 WP_000124693.1.34817 WP_000124693.1.34820 WP_000124693.1.34824 WP_000124693.1.34834 WP_000124693.1.34854 WP_000124693.1.34856 WP_000124693.1.34881 WP_000124693.1.3489 WP_000124693.1.34932 WP_000124693.1.34962 WP_000124693.1.34972 WP_000124693.1.34975 WP_000124693.1.34977 WP_000124693.1.35001 WP_000124693.1.35035 WP_000124693.1.35040 WP_000124693.1.35045 WP_000124693.1.35074 WP_000124693.1.35075 WP_000124693.1.35125 WP_000124693.1.35129 WP_000124693.1.35175 WP_000124693.1.35184 WP_000124693.1.35193 WP_000124693.1.35219 WP_000124693.1.35240 WP_000124693.1.35274 WP_000124693.1.35294 WP_000124693.1.35298 WP_000124693.1.35321 WP_000124693.1.35331 WP_000124693.1.35332 WP_000124693.1.35404 WP_000124693.1.35408 WP_000124693.1.3541 WP_000124693.1.35425 WP_000124693.1.35429 WP_000124693.1.35446 WP_000124693.1.35460 WP_000124693.1.35463 WP_000124693.1.35494 WP_000124693.1.35507 WP_000124693.1.35509 WP_000124693.1.35532 WP_000124693.1.3556 WP_000124693.1.35560 WP_000124693.1.35563 WP_000124693.1.3557 WP_000124693.1.35570 WP_000124693.1.35590 WP_000124693.1.35594 WP_000124693.1.35619 WP_000124693.1.35624 WP_000124693.1.35628 WP_000124693.1.35648 WP_000124693.1.3566 WP_000124693.1.3570 WP_000124693.1.35712 WP_000124693.1.35713 WP_000124693.1.3572 WP_000124693.1.35736 WP_000124693.1.35777 WP_000124693.1.35791 WP_000124693.1.35795 WP_000124693.1.35809 WP_000124693.1.35835 WP_000124693.1.35868 WP_000124693.1.35870 WP_000124693.1.35887 WP_000124693.1.35892 WP_000124693.1.35916 WP_000124693.1.35936 WP_000124693.1.35938 WP_000124693.1.35940 WP_000124693.1.35961 WP_000124693.1.35966 WP_000124693.1.35993 WP_000124693.1.36000 WP_000124693.1.36003 WP_000124693.1.3601 WP_000124693.1.36011 WP_000124693.1.36017 WP_000124693.1.36034 WP_000124693.1.36036 WP_000124693.1.36037 WP_000124693.1.36057 WP_000124693.1.36063 WP_000124693.1.36069 WP_000124693.1.3610 WP_000124693.1.36157 WP_000124693.1.36172 WP_000124693.1.36229 WP_000124693.1.36232 WP_000124693.1.36236 WP_000124693.1.36286 WP_000124693.1.36291 WP_000124693.1.36298 WP_000124693.1.36308 WP_000124693.1.36323 WP_000124693.1.36343 WP_000124693.1.36425 WP_000124693.1.36445 WP_000124693.1.36460 WP_000124693.1.3649 WP_000124693.1.36495 WP_000124693.1.36512 WP_000124693.1.36526 WP_000124693.1.36542 WP_000124693.1.36547 WP_000124693.1.36564 WP_000124693.1.36567 WP_000124693.1.36579 WP_000124693.1.36584 WP_000124693.1.36586 WP_000124693.1.36592 WP_000124693.1.36609 WP_000124693.1.36617 WP_000124693.1.36618 WP_000124693.1.36643 WP_000124693.1.36652 WP_000124693.1.36663 WP_000124693.1.36685 WP_000124693.1.36690 WP_000124693.1.3670 WP_000124693.1.36701 WP_000124693.1.36705 WP_000124693.1.36721 WP_000124693.1.36725 WP_000124693.1.36751 WP_000124693.1.36764 WP_000124693.1.36765 WP_000124693.1.36779 WP_000124693.1.36792 WP_000124693.1.36798 WP_000124693.1.36802 WP_000124693.1.36821 WP_000124693.1.36839 WP_000124693.1.36853 WP_000124693.1.36875 WP_000124693.1.3688 WP_000124693.1.36885 WP_000124693.1.36889 WP_000124693.1.36899 WP_000124693.1.36918 WP_000124693.1.36931 WP_000124693.1.36948 WP_000124693.1.36950 WP_000124693.1.36978 WP_000124693.1.37013 WP_000124693.1.37014 WP_000124693.1.37021 WP_000124693.1.37028 WP_000124693.1.37029 WP_000124693.1.37063 WP_000124693.1.37073 WP_000124693.1.37100 WP_000124693.1.37111 WP_000124693.1.37112 WP_000124693.1.37114 WP_000124693.1.37133 WP_000124693.1.37147 WP_000124693.1.37158 WP_000124693.1.37176 WP_000124693.1.37190 WP_000124693.1.37191 WP_000124693.1.37199 WP_000124693.1.37200 WP_000124693.1.37256 WP_000124693.1.37258 WP_000124693.1.3726 WP_000124693.1.37267 WP_000124693.1.3728 WP_000124693.1.37293 WP_000124693.1.37297 WP_000124693.1.37303 WP_000124693.1.37320 WP_000124693.1.3734 WP_000124693.1.37351 WP_000124693.1.37363 WP_000124693.1.37370 WP_000124693.1.37376 WP_000124693.1.37405 WP_000124693.1.3744 WP_000124693.1.37478 WP_000124693.1.3748 WP_000124693.1.37498 WP_000124693.1.37504 WP_000124693.1.3751 WP_000124693.1.37513 WP_000124693.1.37521 WP_000124693.1.37558 WP_000124693.1.3756 WP_000124693.1.37584 WP_000124693.1.37590 WP_000124693.1.37593 WP_000124693.1.37600 WP_000124693.1.37610 WP_000124693.1.37613 WP_000124693.1.37618 WP_000124693.1.37659 WP_000124693.1.37662 WP_000124693.1.37666 WP_000124693.1.37675 WP_000124693.1.37687 WP_000124693.1.37691 WP_000124693.1.3771 WP_000124693.1.37719 WP_000124693.1.37761 WP_000124693.1.37775 WP_000124693.1.37777 WP_000124693.1.3778 WP_000124693.1.378 WP_000124693.1.37808 WP_000124693.1.37848 WP_000124693.1.37864 WP_000124693.1.379 WP_000124693.1.3790 WP_000124693.1.37911 WP_000124693.1.37941 WP_000124693.1.37965 WP_000124693.1.37968 WP_000124693.1.37978 WP_000124693.1.37985 WP_000124693.1.38001 WP_000124693.1.38026 WP_000124693.1.38037 WP_000124693.1.38047 WP_000124693.1.38055 WP_000124693.1.38061 WP_000124693.1.38064 WP_000124693.1.38108 WP_000124693.1.38113 WP_000124693.1.38125 WP_000124693.1.38145 WP_000124693.1.3816 WP_000124693.1.38199 WP_000124693.1.38207 WP_000124693.1.38261 WP_000124693.1.38266 WP_000124693.1.38273 WP_000124693.1.3828 WP_000124693.1.383 WP_000124693.1.38310 WP_000124693.1.38322 WP_000124693.1.3834 WP_000124693.1.38341 WP_000124693.1.38344 WP_000124693.1.38349 WP_000124693.1.38351 WP_000124693.1.3838 WP_000124693.1.38381 WP_000124693.1.38408 WP_000124693.1.38440 WP_000124693.1.38452 WP_000124693.1.3848 WP_000124693.1.38486 WP_000124693.1.38512 WP_000124693.1.38515 WP_000124693.1.38569 WP_000124693.1.38595 WP_000124693.1.3860 WP_000124693.1.38609 WP_000124693.1.38613 WP_000124693.1.38620 WP_000124693.1.38622 WP_000124693.1.38642 WP_000124693.1.38673 WP_000124693.1.3869 WP_000124693.1.38693 WP_000124693.1.38734 WP_000124693.1.38740 WP_000124693.1.38773 WP_000124693.1.38781 WP_000124693.1.38797 WP_000124693.1.38830 WP_000124693.1.38857 WP_000124693.1.38877 WP_000124693.1.38881 WP_000124693.1.38882 WP_000124693.1.38895 WP_000124693.1.38898 WP_000124693.1.3891 WP_000124693.1.38913 WP_000124693.1.38942 WP_000124693.1.38983 WP_000124693.1.38995 WP_000124693.1.38996 WP_000124693.1.39003 WP_000124693.1.39038 WP_000124693.1.39048 WP_000124693.1.39055 WP_000124693.1.39056 WP_000124693.1.39059 WP_000124693.1.39065 WP_000124693.1.3907 WP_000124693.1.39075 WP_000124693.1.39082 WP_000124693.1.39105 WP_000124693.1.39112 WP_000124693.1.39113 WP_000124693.1.39128 WP_000124693.1.39136 WP_000124693.1.3914 WP_000124693.1.39140 WP_000124693.1.39146 WP_000124693.1.39147 WP_000124693.1.39161 WP_000124693.1.39183 WP_000124693.1.39197 WP_000124693.1.39210 WP_000124693.1.39229 WP_000124693.1.39235 WP_000124693.1.39265 WP_000124693.1.39275 WP_000124693.1.3931 WP_000124693.1.39311 WP_000124693.1.39312 WP_000124693.1.39385 WP_000124693.1.39395 WP_000124693.1.39405 WP_000124693.1.39414 WP_000124693.1.39420 WP_000124693.1.39435 WP_000124693.1.39449 WP_000124693.1.39466 WP_000124693.1.39471 WP_000124693.1.39497 WP_000124693.1.39502 WP_000124693.1.39503 WP_000124693.1.39512 WP_000124693.1.39530 WP_000124693.1.39553 WP_000124693.1.39556 WP_000124693.1.39576 WP_000124693.1.39584 WP_000124693.1.39609 WP_000124693.1.39614 WP_000124693.1.39619 WP_000124693.1.39620 WP_000124693.1.39624 WP_000124693.1.39629 WP_000124693.1.39632 WP_000124693.1.39659 WP_000124693.1.39667 WP_000124693.1.39722 WP_000124693.1.39723 WP_000124693.1.39724 WP_000124693.1.39763 WP_000124693.1.39775 WP_000124693.1.39808 WP_000124693.1.39862 WP_000124693.1.39879 WP_000124693.1.39890 WP_000124693.1.39921 WP_000124693.1.39923 WP_000124693.1.39941 WP_000124693.1.39945 WP_000124693.1.39947 WP_000124693.1.39953 WP_000124693.1.40017 WP_000124693.1.40025 WP_000124693.1.40031 WP_000124693.1.40072 WP_000124693.1.40073 WP_000124693.1.40081 WP_000124693.1.40095 WP_000124693.1.40097 WP_000124693.1.401 WP_000124693.1.4011 WP_000124693.1.40111 WP_000124693.1.40155 WP_000124693.1.40158 WP_000124693.1.40160 WP_000124693.1.40167 WP_000124693.1.40170 WP_000124693.1.40171 WP_000124693.1.40205 WP_000124693.1.40208 WP_000124693.1.40224 WP_000124693.1.40229 WP_000124693.1.40240 WP_000124693.1.40254 WP_000124693.1.40257 WP_000124693.1.40258 WP_000124693.1.40259 WP_000124693.1.40279 WP_000124693.1.40284 WP_000124693.1.40292 WP_000124693.1.40305 WP_000124693.1.40307 WP_000124693.1.40311 WP_000124693.1.40341 WP_000124693.1.40361 WP_000124693.1.40374 WP_000124693.1.40380 WP_000124693.1.40395 WP_000124693.1.4042 WP_000124693.1.40465 WP_000124693.1.40467 WP_000124693.1.40492 WP_000124693.1.40493 WP_000124693.1.40496 WP_000124693.1.40508 WP_000124693.1.40517 WP_000124693.1.40528 WP_000124693.1.40533 WP_000124693.1.40577 WP_000124693.1.40583 WP_000124693.1.40605 WP_000124693.1.40622 WP_000124693.1.40648 WP_000124693.1.40688 WP_000124693.1.40693 WP_000124693.1.40695 WP_000124693.1.40698 WP_000124693.1.40710 WP_000124693.1.40722 WP_000124693.1.40745 WP_000124693.1.4075 WP_000124693.1.40750 WP_000124693.1.40763 WP_000124693.1.40771 WP_000124693.1.40788 WP_000124693.1.40849 WP_000124693.1.40854 WP_000124693.1.4087 WP_000124693.1.40877 WP_000124693.1.4088 WP_000124693.1.4089 WP_000124693.1.40910 WP_000124693.1.40924 WP_000124693.1.40930 WP_000124693.1.40932 WP_000124693.1.40935 WP_000124693.1.40946 WP_000124693.1.40973 WP_000124693.1.40979 WP_000124693.1.40996 WP_000124693.1.41004 WP_000124693.1.41017 WP_000124693.1.41018 WP_000124693.1.41048 WP_000124693.1.41050 WP_000124693.1.4106 WP_000124693.1.41070 WP_000124693.1.41074 WP_000124693.1.41075 WP_000124693.1.41086 WP_000124693.1.4109 WP_000124693.1.41091 WP_000124693.1.41097 WP_000124693.1.41116 WP_000124693.1.41128 WP_000124693.1.41132 WP_000124693.1.4114 WP_000124693.1.41176 WP_000124693.1.41192 WP_000124693.1.41225 WP_000124693.1.41226 WP_000124693.1.41251 WP_000124693.1.41258 WP_000124693.1.41265 WP_000124693.1.41277 WP_000124693.1.41279 WP_000124693.1.41299 WP_000124693.1.41305 WP_000124693.1.41308 WP_000124693.1.41310 WP_000124693.1.41321 WP_000124693.1.41333 WP_000124693.1.41335 WP_000124693.1.41345 WP_000124693.1.4136 WP_000124693.1.41375 WP_000124693.1.4141 WP_000124693.1.41415 WP_000124693.1.41427 WP_000124693.1.41434 WP_000124693.1.41440 WP_000124693.1.41459 WP_000124693.1.41468 WP_000124693.1.41498 WP_000124693.1.41516 WP_000124693.1.41519 WP_000124693.1.41524 WP_000124693.1.41528 WP_000124693.1.41554 WP_000124693.1.41572 WP_000124693.1.41591 WP_000124693.1.41593 WP_000124693.1.41610 WP_000124693.1.41628 WP_000124693.1.41631 WP_000124693.1.41658 WP_000124693.1.41659 WP_000124693.1.41662 WP_000124693.1.41688 WP_000124693.1.41690 WP_000124693.1.41708 WP_000124693.1.41716 WP_000124693.1.41724 WP_000124693.1.41735 WP_000124693.1.41746 WP_000124693.1.41761 WP_000124693.1.4178 WP_000124693.1.41789 WP_000124693.1.41799 WP_000124693.1.41802 WP_000124693.1.41824 WP_000124693.1.41825 WP_000124693.1.41836 WP_000124693.1.4184 WP_000124693.1.41859 WP_000124693.1.41862 WP_000124693.1.41877 WP_000124693.1.41882 WP_000124693.1.41894 WP_000124693.1.41897 WP_000124693.1.41904 WP_000124693.1.41911 WP_000124693.1.41919 WP_000124693.1.41929 WP_000124693.1.41931 WP_000124693.1.41938 WP_000124693.1.4194 WP_000124693.1.41949 WP_000124693.1.41978 WP_000124693.1.41979 WP_000124693.1.41985 WP_000124693.1.41994 WP_000124693.1.41998 WP_000124693.1.42009 WP_000124693.1.42069 WP_000124693.1.42081 WP_000124693.1.42090 WP_000124693.1.42098 WP_000124693.1.42104 WP_000124693.1.42109 WP_000124693.1.42111 WP_000124693.1.42136 WP_000124693.1.42156 WP_000124693.1.42187 WP_000124693.1.422 WP_000124693.1.42200 WP_000124693.1.42219 WP_000124693.1.4222 WP_000124693.1.42238 WP_000124693.1.42243 WP_000124693.1.42244 WP_000124693.1.42248 WP_000124693.1.42257 WP_000124693.1.42261 WP_000124693.1.42262 WP_000124693.1.42263 WP_000124693.1.4229 WP_000124693.1.42320 WP_000124693.1.42322 WP_000124693.1.42328 WP_000124693.1.42342 WP_000124693.1.42349 WP_000124693.1.42356 WP_000124693.1.42364 WP_000124693.1.42371 WP_000124693.1.42372 WP_000124693.1.42379 WP_000124693.1.4239 WP_000124693.1.42391 WP_000124693.1.42392 WP_000124693.1.42399 WP_000124693.1.42404 WP_000124693.1.42422 WP_000124693.1.42433 WP_000124693.1.42444 WP_000124693.1.42453 WP_000124693.1.42489 WP_000124693.1.42491 WP_000124693.1.42539 WP_000124693.1.4257 WP_000124693.1.42595 WP_000124693.1.42603 WP_000124693.1.42605 WP_000124693.1.42650 WP_000124693.1.42655 WP_000124693.1.42666 WP_000124693.1.4267 WP_000124693.1.42675 WP_000124693.1.42676 WP_000124693.1.42683 WP_000124693.1.42685 WP_000124693.1.42701 WP_000124693.1.42707 WP_000124693.1.42734 WP_000124693.1.4276 WP_000124693.1.42767 WP_000124693.1.42794 WP_000124693.1.42797 WP_000124693.1.42805 WP_000124693.1.42815 WP_000124693.1.42829 WP_000124693.1.42859 WP_000124693.1.42861 WP_000124693.1.42864 WP_000124693.1.4288 WP_000124693.1.42887 WP_000124693.1.4289 WP_000124693.1.42892 WP_000124693.1.42923 WP_000124693.1.42932 WP_000124693.1.42957 WP_000124693.1.42978 WP_000124693.1.4298 WP_000124693.1.42981 WP_000124693.1.43008 WP_000124693.1.43016 WP_000124693.1.43018 WP_000124693.1.43019 WP_000124693.1.43041 WP_000124693.1.43065 WP_000124693.1.43068 WP_000124693.1.43069 WP_000124693.1.43070 WP_000124693.1.43077 WP_000124693.1.43086 WP_000124693.1.43089 WP_000124693.1.43126 WP_000124693.1.43128 WP_000124693.1.43141 WP_000124693.1.43149 WP_000124693.1.43157 WP_000124693.1.43160 WP_000124693.1.43161 WP_000124693.1.43190 WP_000124693.1.43198 WP_000124693.1.43201 WP_000124693.1.43244 WP_000124693.1.43258 WP_000124693.1.4326 WP_000124693.1.43272 WP_000124693.1.43276 WP_000124693.1.43290 WP_000124693.1.43292 WP_000124693.1.43299 WP_000124693.1.43307 WP_000124693.1.4332 WP_000124693.1.43334 WP_000124693.1.43339 WP_000124693.1.43351 WP_000124693.1.43371 WP_000124693.1.43437 WP_000124693.1.43438 WP_000124693.1.4344 WP_000124693.1.43441 WP_000124693.1.43476 WP_000124693.1.43508 WP_000124693.1.43513 WP_000124693.1.43520 WP_000124693.1.43522 WP_000124693.1.43528 WP_000124693.1.43535 WP_000124693.1.43606 WP_000124693.1.43613 WP_000124693.1.43633 WP_000124693.1.43637 WP_000124693.1.43651 WP_000124693.1.43654 WP_000124693.1.43668 WP_000124693.1.43676 WP_000124693.1.43685 WP_000124693.1.43710 WP_000124693.1.43711 WP_000124693.1.43722 WP_000124693.1.4373 WP_000124693.1.43763 WP_000124693.1.43778 WP_000124693.1.43782 WP_000124693.1.43785 WP_000124693.1.43801 WP_000124693.1.43812 WP_000124693.1.43828 WP_000124693.1.43839 WP_000124693.1.43864 WP_000124693.1.43873 WP_000124693.1.43875 WP_000124693.1.43878 WP_000124693.1.43886 WP_000124693.1.43888 WP_000124693.1.43919 WP_000124693.1.43951 WP_000124693.1.43954 WP_000124693.1.43974 WP_000124693.1.44005 WP_000124693.1.44010 WP_000124693.1.4404 WP_000124693.1.44043 WP_000124693.1.44049 WP_000124693.1.4405 WP_000124693.1.44063 WP_000124693.1.44099 WP_000124693.1.44101 WP_000124693.1.44113 WP_000124693.1.44121 WP_000124693.1.44132 WP_000124693.1.44144 WP_000124693.1.44160 WP_000124693.1.44180 WP_000124693.1.44187 WP_000124693.1.44191 WP_000124693.1.44196 WP_000124693.1.4422 WP_000124693.1.4423 WP_000124693.1.44248 WP_000124693.1.44250 WP_000124693.1.44262 WP_000124693.1.44268 WP_000124693.1.4427 WP_000124693.1.44291 WP_000124693.1.44296 WP_000124693.1.44300 WP_000124693.1.44310 WP_000124693.1.44337 WP_000124693.1.44339 WP_000124693.1.44343 WP_000124693.1.44351 WP_000124693.1.44359 WP_000124693.1.44360 WP_000124693.1.44380 WP_000124693.1.44386 WP_000124693.1.44397 WP_000124693.1.4440 WP_000124693.1.44416 WP_000124693.1.44431 WP_000124693.1.44433 WP_000124693.1.44438 WP_000124693.1.44440 WP_000124693.1.44443 WP_000124693.1.44453 WP_000124693.1.44474 WP_000124693.1.44479 WP_000124693.1.44546 WP_000124693.1.44549 WP_000124693.1.44578 WP_000124693.1.44593 WP_000124693.1.44606 WP_000124693.1.44607 WP_000124693.1.44633 WP_000124693.1.44636 WP_000124693.1.44640 WP_000124693.1.4467 WP_000124693.1.44678 WP_000124693.1.4468 WP_000124693.1.44687 WP_000124693.1.44702 WP_000124693.1.44705 WP_000124693.1.44747 WP_000124693.1.44762 WP_000124693.1.44781 WP_000124693.1.44791 WP_000124693.1.44795 WP_000124693.1.44815 WP_000124693.1.44828 WP_000124693.1.44831 WP_000124693.1.44833 WP_000124693.1.4485 WP_000124693.1.44877 WP_000124693.1.44879 WP_000124693.1.44887 WP_000124693.1.449 WP_000124693.1.44917 WP_000124693.1.44927 WP_000124693.1.44933 WP_000124693.1.44943 WP_000124693.1.44950 WP_000124693.1.44966 WP_000124693.1.44971 WP_000124693.1.44978 WP_000124693.1.44985 WP_000124693.1.44996 WP_000124693.1.44997 WP_000124693.1.44998 WP_000124693.1.4501 WP_000124693.1.45027 WP_000124693.1.45038 WP_000124693.1.45045 WP_000124693.1.4505 WP_000124693.1.45067 WP_000124693.1.45072 WP_000124693.1.45074 WP_000124693.1.45079 WP_000124693.1.45093 WP_000124693.1.45098 WP_000124693.1.45123 WP_000124693.1.45134 WP_000124693.1.45136 WP_000124693.1.45138 WP_000124693.1.45145 WP_000124693.1.45154 WP_000124693.1.45173 WP_000124693.1.45177 WP_000124693.1.45184 WP_000124693.1.45229 WP_000124693.1.45241 WP_000124693.1.45251 WP_000124693.1.45259 WP_000124693.1.45268 WP_000124693.1.45302 WP_000124693.1.4531 WP_000124693.1.45322 WP_000124693.1.45344 WP_000124693.1.45349 WP_000124693.1.45351 WP_000124693.1.45365 WP_000124693.1.4540 WP_000124693.1.45402 WP_000124693.1.45432 WP_000124693.1.45434 WP_000124693.1.45435 WP_000124693.1.45462 WP_000124693.1.45468 WP_000124693.1.45522 WP_000124693.1.45523 WP_000124693.1.45535 WP_000124693.1.45544 WP_000124693.1.45549 WP_000124693.1.45550 WP_000124693.1.45566 WP_000124693.1.45569 WP_000124693.1.45571 WP_000124693.1.45582 WP_000124693.1.45583 WP_000124693.1.45585 WP_000124693.1.45596 WP_000124693.1.45622 WP_000124693.1.45648 WP_000124693.1.45660 WP_000124693.1.45690 WP_000124693.1.45706 WP_000124693.1.45781 WP_000124693.1.45797 WP_000124693.1.458 WP_000124693.1.45829 WP_000124693.1.45844 WP_000124693.1.45848 WP_000124693.1.45871 WP_000124693.1.45906 WP_000124693.1.45918 WP_000124693.1.4592 WP_000124693.1.45947 WP_000124693.1.45984 WP_000124693.1.46011 WP_000124693.1.46028 WP_000124693.1.46030 WP_000124693.1.46069 WP_000124693.1.46077 WP_000124693.1.46091 WP_000124693.1.46124 WP_000124693.1.46169 WP_000124693.1.46173 WP_000124693.1.46174 WP_000124693.1.46187 WP_000124693.1.46203 WP_000124693.1.46215 WP_000124693.1.46225 WP_000124693.1.46232 WP_000124693.1.46241 WP_000124693.1.46243 WP_000124693.1.46250 WP_000124693.1.46278 WP_000124693.1.46286 WP_000124693.1.46299 WP_000124693.1.46303 WP_000124693.1.46307 WP_000124693.1.46322 WP_000124693.1.46323 WP_000124693.1.46345 WP_000124693.1.46355 WP_000124693.1.46358 WP_000124693.1.464 WP_000124693.1.46406 WP_000124693.1.46434 WP_000124693.1.46444 WP_000124693.1.46454 WP_000124693.1.46461 WP_000124693.1.46499 WP_000124693.1.46504 WP_000124693.1.46505 WP_000124693.1.46551 WP_000124693.1.46559 WP_000124693.1.46572 WP_000124693.1.46574 WP_000124693.1.46578 WP_000124693.1.46595 WP_000124693.1.46620 WP_000124693.1.46637 WP_000124693.1.46666 WP_000124693.1.46675 WP_000124693.1.46689 WP_000124693.1.46693 WP_000124693.1.46701 WP_000124693.1.4671 WP_000124693.1.46726 WP_000124693.1.46730 WP_000124693.1.46732 WP_000124693.1.4674 WP_000124693.1.46781 WP_000124693.1.46803 WP_000124693.1.46804 WP_000124693.1.46816 WP_000124693.1.46842 WP_000124693.1.4686 WP_000124693.1.4690 WP_000124693.1.46920 WP_000124693.1.46930 WP_000124693.1.46945 WP_000124693.1.46961 WP_000124693.1.46967 WP_000124693.1.46976 WP_000124693.1.47005 WP_000124693.1.47008 WP_000124693.1.47014 WP_000124693.1.47023 WP_000124693.1.47036 WP_000124693.1.47037 WP_000124693.1.47042 WP_000124693.1.47057 WP_000124693.1.47058 WP_000124693.1.47059 WP_000124693.1.47061 WP_000124693.1.47067 WP_000124693.1.47085 WP_000124693.1.47110 WP_000124693.1.47123 WP_000124693.1.47214 WP_000124693.1.47215 WP_000124693.1.47243 WP_000124693.1.47245 WP_000124693.1.47257 WP_000124693.1.47389 WP_000124693.1.47429 WP_000124693.1.47442 WP_000124693.1.47448 WP_000124693.1.47460 WP_000124693.1.4747 WP_000124693.1.47472 WP_000124693.1.47478 WP_000124693.1.47482 WP_000124693.1.47492 WP_000124693.1.47506 WP_000124693.1.47507 WP_000124693.1.47523 WP_000124693.1.47531 WP_000124693.1.47532 WP_000124693.1.47542 WP_000124693.1.47567 WP_000124693.1.47576 WP_000124693.1.47579 WP_000124693.1.4758 WP_000124693.1.47587 WP_000124693.1.47605 WP_000124693.1.47614 WP_000124693.1.47621 WP_000124693.1.47630 WP_000124693.1.47649 WP_000124693.1.47660 WP_000124693.1.4769 WP_000124693.1.4770 WP_000124693.1.47714 WP_000124693.1.4774 WP_000124693.1.4775 WP_000124693.1.47756 WP_000124693.1.47767 WP_000124693.1.47799 WP_000124693.1.4781 WP_000124693.1.47814 WP_000124693.1.47817 WP_000124693.1.47829 WP_000124693.1.47849 WP_000124693.1.47850 WP_000124693.1.47875 WP_000124693.1.47886 WP_000124693.1.47898 WP_000124693.1.47911 WP_000124693.1.47928 WP_000124693.1.4795 WP_000124693.1.47988 WP_000124693.1.47992 WP_000124693.1.48019 WP_000124693.1.48100 WP_000124693.1.48114 WP_000124693.1.48124 WP_000124693.1.48132 WP_000124693.1.48134 WP_000124693.1.48139 WP_000124693.1.48190 WP_000124693.1.48209 WP_000124693.1.48215 WP_000124693.1.48218 WP_000124693.1.48242 WP_000124693.1.48244 WP_000124693.1.48247 WP_000124693.1.48253 WP_000124693.1.48262 WP_000124693.1.48268 WP_000124693.1.48292 WP_000124693.1.483 WP_000124693.1.48324 WP_000124693.1.48367 WP_000124693.1.48377 WP_000124693.1.4839 WP_000124693.1.48399 WP_000124693.1.48426 WP_000124693.1.48430 WP_000124693.1.48436 WP_000124693.1.48455 WP_000124693.1.48493 WP_000124693.1.48510 WP_000124693.1.48524 WP_000124693.1.4853 WP_000124693.1.48570 WP_000124693.1.48586 WP_000124693.1.4859 WP_000124693.1.48591 WP_000124693.1.48610 WP_000124693.1.48631 WP_000124693.1.48647 WP_000124693.1.48651 WP_000124693.1.48663 WP_000124693.1.48690 WP_000124693.1.48734 WP_000124693.1.48751 WP_000124693.1.48755 WP_000124693.1.48756 WP_000124693.1.48768 WP_000124693.1.48774 WP_000124693.1.48778 WP_000124693.1.48788 WP_000124693.1.48797 WP_000124693.1.48841 WP_000124693.1.48849 WP_000124693.1.4885 WP_000124693.1.48855 WP_000124693.1.48876 WP_000124693.1.48886 WP_000124693.1.48894 WP_000124693.1.48896 WP_000124693.1.48908 WP_000124693.1.48918 WP_000124693.1.48919 WP_000124693.1.48931 WP_000124693.1.48955 WP_000124693.1.48963 WP_000124693.1.48973 WP_000124693.1.48985 WP_000124693.1.49004 WP_000124693.1.49005 WP_000124693.1.49012 WP_000124693.1.49041 WP_000124693.1.49084 WP_000124693.1.49090 WP_000124693.1.49102 WP_000124693.1.49106 WP_000124693.1.49113 WP_000124693.1.49117 WP_000124693.1.49121 WP_000124693.1.4914 WP_000124693.1.49140 WP_000124693.1.49153 WP_000124693.1.49155 WP_000124693.1.49162 WP_000124693.1.49166 WP_000124693.1.49175 WP_000124693.1.49204 WP_000124693.1.49214 WP_000124693.1.49226 WP_000124693.1.49233 WP_000124693.1.49239 WP_000124693.1.49256 WP_000124693.1.49262 WP_000124693.1.49276 WP_000124693.1.49290 WP_000124693.1.49304 WP_000124693.1.49309 WP_000124693.1.49311 WP_000124693.1.49334 WP_000124693.1.49340 WP_000124693.1.49355 WP_000124693.1.49358 WP_000124693.1.49366 WP_000124693.1.49375 WP_000124693.1.49429 WP_000124693.1.49430 WP_000124693.1.49434 WP_000124693.1.49443 WP_000124693.1.49450 WP_000124693.1.49472 WP_000124693.1.49490 WP_000124693.1.49494 WP_000124693.1.495 WP_000124693.1.49515 WP_000124693.1.49545 WP_000124693.1.49550 WP_000124693.1.49572 WP_000124693.1.49574 WP_000124693.1.49590 WP_000124693.1.49595 WP_000124693.1.49602 WP_000124693.1.49626 WP_000124693.1.49630 WP_000124693.1.49647 WP_000124693.1.49650 WP_000124693.1.49686 WP_000124693.1.49703 WP_000124693.1.49769 WP_000124693.1.49770 WP_000124693.1.49778 WP_000124693.1.49780 WP_000124693.1.4979 WP_000124693.1.49790 WP_000124693.1.49803 WP_000124693.1.49805 WP_000124693.1.49827 WP_000124693.1.49846 WP_000124693.1.49848 WP_000124693.1.4991 WP_000124693.1.49929 WP_000124693.1.49931 WP_000124693.1.49947 WP_000124693.1.49959 WP_000124693.1.49997 WP_000124693.1.50 WP_000124693.1.50003 WP_000124693.1.50007 WP_000124693.1.50014 WP_000124693.1.50030 WP_000124693.1.50043 WP_000124693.1.50080 WP_000124693.1.5009 WP_000124693.1.50103 WP_000124693.1.50128 WP_000124693.1.50153 WP_000124693.1.50158 WP_000124693.1.50161 WP_000124693.1.50198 WP_000124693.1.50211 WP_000124693.1.50238 WP_000124693.1.50239 WP_000124693.1.50247 WP_000124693.1.50251 WP_000124693.1.50285 WP_000124693.1.50308 WP_000124693.1.50309 WP_000124693.1.50332 WP_000124693.1.50349 WP_000124693.1.50374 WP_000124693.1.50376 WP_000124693.1.50386 WP_000124693.1.50387 WP_000124693.1.50389 WP_000124693.1.50404 WP_000124693.1.50406 WP_000124693.1.50413 WP_000124693.1.50449 WP_000124693.1.50468 WP_000124693.1.50469 WP_000124693.1.50478 WP_000124693.1.50480 WP_000124693.1.50497 WP_000124693.1.5051 WP_000124693.1.50517 WP_000124693.1.50529 WP_000124693.1.50563 WP_000124693.1.50565 WP_000124693.1.50566 WP_000124693.1.50570 WP_000124693.1.50576 WP_000124693.1.5058 WP_000124693.1.50593 WP_000124693.1.50626 WP_000124693.1.50652 WP_000124693.1.50676 WP_000124693.1.50684 WP_000124693.1.50726 WP_000124693.1.50750 WP_000124693.1.50769 WP_000124693.1.50771 WP_000124693.1.50774 WP_000124693.1.50777 WP_000124693.1.50782 WP_000124693.1.50800 WP_000124693.1.50804 WP_000124693.1.50808 WP_000124693.1.50811 WP_000124693.1.50875 WP_000124693.1.5088 WP_000124693.1.50882 WP_000124693.1.50885 WP_000124693.1.50893 WP_000124693.1.509 WP_000124693.1.50905 WP_000124693.1.50908 WP_000124693.1.50918 WP_000124693.1.50929 WP_000124693.1.50941 WP_000124693.1.50954 WP_000124693.1.50960 WP_000124693.1.50970 WP_000124693.1.50999 WP_000124693.1.51014 WP_000124693.1.51022 WP_000124693.1.51025 WP_000124693.1.51036 WP_000124693.1.51040 WP_000124693.1.51048 WP_000124693.1.51066 WP_000124693.1.51100 WP_000124693.1.51117 WP_000124693.1.51134 WP_000124693.1.51139 WP_000124693.1.5114 WP_000124693.1.51162 WP_000124693.1.51178 WP_000124693.1.51179 WP_000124693.1.51182 WP_000124693.1.51186 WP_000124693.1.51224 WP_000124693.1.51227 WP_000124693.1.5125 WP_000124693.1.5127 WP_000124693.1.51285 WP_000124693.1.51305 WP_000124693.1.51308 WP_000124693.1.51315 WP_000124693.1.51331 WP_000124693.1.51338 WP_000124693.1.51356 WP_000124693.1.5136 WP_000124693.1.5138 WP_000124693.1.51394 WP_000124693.1.51412 WP_000124693.1.51414 WP_000124693.1.51419 WP_000124693.1.51451 WP_000124693.1.51464 WP_000124693.1.51474 WP_000124693.1.51487 WP_000124693.1.51488 WP_000124693.1.51502 WP_000124693.1.51506 WP_000124693.1.51514 WP_000124693.1.51518 WP_000124693.1.51519 WP_000124693.1.51555 WP_000124693.1.51594 WP_000124693.1.51598 WP_000124693.1.51611 WP_000124693.1.51613 WP_000124693.1.51615 WP_000124693.1.51634 WP_000124693.1.51642 WP_000124693.1.51644 WP_000124693.1.51649 WP_000124693.1.51686 WP_000124693.1.51700 WP_000124693.1.51704 WP_000124693.1.51724 WP_000124693.1.51734 WP_000124693.1.51756 WP_000124693.1.51764 WP_000124693.1.51810 WP_000124693.1.51831 WP_000124693.1.51838 WP_000124693.1.51841 WP_000124693.1.5185 WP_000124693.1.51863 WP_000124693.1.51868 WP_000124693.1.51888 WP_000124693.1.51900 WP_000124693.1.51910 WP_000124693.1.51911 WP_000124693.1.51914 WP_000124693.1.51930 WP_000124693.1.51932 WP_000124693.1.51935 WP_000124693.1.51989 WP_000124693.1.51994 WP_000124693.1.520 WP_000124693.1.52047 WP_000124693.1.52052 WP_000124693.1.52057 WP_000124693.1.52101 WP_000124693.1.5211 WP_000124693.1.52114 WP_000124693.1.52121 WP_000124693.1.52123 WP_000124693.1.52129 WP_000124693.1.52148 WP_000124693.1.52156 WP_000124693.1.5216 WP_000124693.1.52161 WP_000124693.1.52170 WP_000124693.1.52191 WP_000124693.1.52202 WP_000124693.1.52209 WP_000124693.1.52255 WP_000124693.1.52301 WP_000124693.1.52321 WP_000124693.1.52336 WP_000124693.1.52339 WP_000124693.1.52346 WP_000124693.1.52353 WP_000124693.1.52356 WP_000124693.1.52361 WP_000124693.1.52438 WP_000124693.1.52446 WP_000124693.1.52456 WP_000124693.1.52469 WP_000124693.1.52527 WP_000124693.1.52528 WP_000124693.1.52571 WP_000124693.1.52582 WP_000124693.1.52586 WP_000124693.1.526 WP_000124693.1.52608 WP_000124693.1.52637 WP_000124693.1.52647 WP_000124693.1.52653 WP_000124693.1.52675 WP_000124693.1.52692 WP_000124693.1.5273 WP_000124693.1.52738 WP_000124693.1.52742 WP_000124693.1.52743 WP_000124693.1.52744 WP_000124693.1.52748 WP_000124693.1.52773 WP_000124693.1.52795 WP_000124693.1.52807 WP_000124693.1.52824 WP_000124693.1.52833 WP_000124693.1.52851 WP_000124693.1.52857 WP_000124693.1.52858 WP_000124693.1.52866 WP_000124693.1.52887 WP_000124693.1.52898 WP_000124693.1.52915 WP_000124693.1.52924 WP_000124693.1.52949 WP_000124693.1.5301 WP_000124693.1.53016 WP_000124693.1.53092 WP_000124693.1.53100 WP_000124693.1.53107 WP_000124693.1.53119 WP_000124693.1.5313 WP_000124693.1.53141 WP_000124693.1.53151 WP_000124693.1.53154 WP_000124693.1.53158 WP_000124693.1.53159 WP_000124693.1.5316 WP_000124693.1.53179 WP_000124693.1.53190 WP_000124693.1.53198 WP_000124693.1.53203 WP_000124693.1.53206 WP_000124693.1.53210 WP_000124693.1.53233 WP_000124693.1.53234 WP_000124693.1.53272 WP_000124693.1.53274 WP_000124693.1.53286 WP_000124693.1.53307 WP_000124693.1.53315 WP_000124693.1.53316 WP_000124693.1.53321 WP_000124693.1.53328 WP_000124693.1.5333 WP_000124693.1.53362 WP_000124693.1.53368 WP_000124693.1.53375 WP_000124693.1.53385 WP_000124693.1.53406 WP_000124693.1.53436 WP_000124693.1.53450 WP_000124693.1.53454 WP_000124693.1.53466 WP_000124693.1.5349 WP_000124693.1.53529 WP_000124693.1.53534 WP_000124693.1.53540 WP_000124693.1.53543 WP_000124693.1.53555 WP_000124693.1.53559 WP_000124693.1.5356 WP_000124693.1.53567 WP_000124693.1.53571 WP_000124693.1.5358 WP_000124693.1.53664 WP_000124693.1.53675 WP_000124693.1.53688 WP_000124693.1.53692 WP_000124693.1.53694 WP_000124693.1.53723 WP_000124693.1.5374 WP_000124693.1.53750 WP_000124693.1.53757 WP_000124693.1.53778 WP_000124693.1.53781 WP_000124693.1.53790 WP_000124693.1.53800 WP_000124693.1.53812 WP_000124693.1.53814 WP_000124693.1.53815 WP_000124693.1.53839 WP_000124693.1.53892 WP_000124693.1.53896 WP_000124693.1.53898 WP_000124693.1.53902 WP_000124693.1.53905 WP_000124693.1.5392 WP_000124693.1.53935 WP_000124693.1.53958 WP_000124693.1.53961 WP_000124693.1.53981 WP_000124693.1.53984 WP_000124693.1.54033 WP_000124693.1.54061 WP_000124693.1.54068 WP_000124693.1.54075 WP_000124693.1.54082 WP_000124693.1.54085 WP_000124693.1.54132 WP_000124693.1.54136 WP_000124693.1.5415 WP_000124693.1.54159 WP_000124693.1.54170 WP_000124693.1.54175 WP_000124693.1.54196 WP_000124693.1.542 WP_000124693.1.54203 WP_000124693.1.54209 WP_000124693.1.54259 WP_000124693.1.54271 WP_000124693.1.54273 WP_000124693.1.54274 WP_000124693.1.54283 WP_000124693.1.5430 WP_000124693.1.54319 WP_000124693.1.54324 WP_000124693.1.54333 WP_000124693.1.54340 WP_000124693.1.54364 WP_000124693.1.54366 WP_000124693.1.54371 WP_000124693.1.54400 WP_000124693.1.54431 WP_000124693.1.54442 WP_000124693.1.54469 WP_000124693.1.54482 WP_000124693.1.54500 WP_000124693.1.54522 WP_000124693.1.54526 WP_000124693.1.54558 WP_000124693.1.5456 WP_000124693.1.54569 WP_000124693.1.54589 WP_000124693.1.5459 WP_000124693.1.54607 WP_000124693.1.54615 WP_000124693.1.5462 WP_000124693.1.54644 WP_000124693.1.54662 WP_000124693.1.54667 WP_000124693.1.54678 WP_000124693.1.54681 WP_000124693.1.54694 WP_000124693.1.54722 WP_000124693.1.54748 WP_000124693.1.54749 WP_000124693.1.54764 WP_000124693.1.54774 WP_000124693.1.5481 WP_000124693.1.54814 WP_000124693.1.54822 WP_000124693.1.54827 WP_000124693.1.54833 WP_000124693.1.54845 WP_000124693.1.5485 WP_000124693.1.54865 WP_000124693.1.54877 WP_000124693.1.5493 WP_000124693.1.54935 WP_000124693.1.54936 WP_000124693.1.54979 WP_000124693.1.54984 WP_000124693.1.54992 WP_000124693.1.55008 WP_000124693.1.55010 WP_000124693.1.55034 WP_000124693.1.55073 WP_000124693.1.55152 WP_000124693.1.55156 WP_000124693.1.55163 WP_000124693.1.55165 WP_000124693.1.55166 WP_000124693.1.5517 WP_000124693.1.55178 WP_000124693.1.55200 WP_000124693.1.55215 WP_000124693.1.55223 WP_000124693.1.55224 WP_000124693.1.5523 WP_000124693.1.5525 WP_000124693.1.5527 WP_000124693.1.55285 WP_000124693.1.55290 WP_000124693.1.55310 WP_000124693.1.55317 WP_000124693.1.55325 WP_000124693.1.55361 WP_000124693.1.55379 WP_000124693.1.5539 WP_000124693.1.55418 WP_000124693.1.55430 WP_000124693.1.55461 WP_000124693.1.55468 WP_000124693.1.55475 WP_000124693.1.55477 WP_000124693.1.55496 WP_000124693.1.55506 WP_000124693.1.5552 WP_000124693.1.55528 WP_000124693.1.55545 WP_000124693.1.5555 WP_000124693.1.55554 WP_000124693.1.55557 WP_000124693.1.55559 WP_000124693.1.5560 WP_000124693.1.55614 WP_000124693.1.55623 WP_000124693.1.55639 WP_000124693.1.55640 WP_000124693.1.55647 WP_000124693.1.55672 WP_000124693.1.55680 WP_000124693.1.55699 WP_000124693.1.55706 WP_000124693.1.55718 WP_000124693.1.5572 WP_000124693.1.55725 WP_000124693.1.55743 WP_000124693.1.55768 WP_000124693.1.5577 WP_000124693.1.55780 WP_000124693.1.55782 WP_000124693.1.55796 WP_000124693.1.55803 WP_000124693.1.55853 WP_000124693.1.55923 WP_000124693.1.55948 WP_000124693.1.55967 WP_000124693.1.55973 WP_000124693.1.55993 WP_000124693.1.55995 WP_000124693.1.56002 WP_000124693.1.56004 WP_000124693.1.56012 WP_000124693.1.56026 WP_000124693.1.56059 WP_000124693.1.56069 WP_000124693.1.56070 WP_000124693.1.56082 WP_000124693.1.56097 WP_000124693.1.56100 WP_000124693.1.56105 WP_000124693.1.56130 WP_000124693.1.56144 WP_000124693.1.56152 WP_000124693.1.56172 WP_000124693.1.5621 WP_000124693.1.56222 WP_000124693.1.56226 WP_000124693.1.56235 WP_000124693.1.56238 WP_000124693.1.56244 WP_000124693.1.56247 WP_000124693.1.56261 WP_000124693.1.56263 WP_000124693.1.56286 WP_000124693.1.56303 WP_000124693.1.56304 WP_000124693.1.56305 WP_000124693.1.56311 WP_000124693.1.5633 WP_000124693.1.56354 WP_000124693.1.56368 WP_000124693.1.56370 WP_000124693.1.56374 WP_000124693.1.56389 WP_000124693.1.56393 WP_000124693.1.56396 WP_000124693.1.56413 WP_000124693.1.56414 WP_000124693.1.56419 WP_000124693.1.56420 WP_000124693.1.56423 WP_000124693.1.56438 WP_000124693.1.56468 WP_000124693.1.56512 WP_000124693.1.56514 WP_000124693.1.56535 WP_000124693.1.56559 WP_000124693.1.56560 WP_000124693.1.56585 WP_000124693.1.56597 WP_000124693.1.56601 WP_000124693.1.56614 WP_000124693.1.56615 WP_000124693.1.56640 WP_000124693.1.56642 WP_000124693.1.56647 WP_000124693.1.56651 WP_000124693.1.56660 WP_000124693.1.56671 WP_000124693.1.5668 WP_000124693.1.56682 WP_000124693.1.56724 WP_000124693.1.56791 WP_000124693.1.56824 WP_000124693.1.56825 WP_000124693.1.56851 WP_000124693.1.56853 WP_000124693.1.56861 WP_000124693.1.56875 WP_000124693.1.56877 WP_000124693.1.56887 WP_000124693.1.56889 WP_000124693.1.56893 WP_000124693.1.56898 WP_000124693.1.56905 WP_000124693.1.56942 WP_000124693.1.56950 WP_000124693.1.56981 WP_000124693.1.57000 WP_000124693.1.57026 WP_000124693.1.57039 WP_000124693.1.57056 WP_000124693.1.57076 WP_000124693.1.57084 WP_000124693.1.57101 WP_000124693.1.5711 WP_000124693.1.57125 WP_000124693.1.57137 WP_000124693.1.57143 WP_000124693.1.57147 WP_000124693.1.57149 WP_000124693.1.57168 WP_000124693.1.57179 WP_000124693.1.57186 WP_000124693.1.57187 WP_000124693.1.57232 WP_000124693.1.57244 WP_000124693.1.57246 WP_000124693.1.57296 WP_000124693.1.57307 WP_000124693.1.57342 WP_000124693.1.57344 WP_000124693.1.57356 WP_000124693.1.57357 WP_000124693.1.57362 WP_000124693.1.57377 WP_000124693.1.57399 WP_000124693.1.57418 WP_000124693.1.57433 WP_000124693.1.57494 WP_000124693.1.57495 WP_000124693.1.57510 WP_000124693.1.57515 WP_000124693.1.57529 WP_000124693.1.5753 WP_000124693.1.57534 WP_000124693.1.57555 WP_000124693.1.57559 WP_000124693.1.57576 WP_000124693.1.57601 WP_000124693.1.57607 WP_000124693.1.5761 WP_000124693.1.57631 WP_000124693.1.57641 WP_000124693.1.57684 WP_000124693.1.57699 WP_000124693.1.57709 WP_000124693.1.57710 WP_000124693.1.57735 WP_000124693.1.5774 WP_000124693.1.57763 WP_000124693.1.57778 WP_000124693.1.57781 WP_000124693.1.57785 WP_000124693.1.57797 WP_000124693.1.57800 WP_000124693.1.5781 WP_000124693.1.57835 WP_000124693.1.57857 WP_000124693.1.57862 WP_000124693.1.57873 WP_000124693.1.57890 WP_000124693.1.57891 WP_000124693.1.57893 WP_000124693.1.57902 WP_000124693.1.57965 WP_000124693.1.57972 WP_000124693.1.57978 WP_000124693.1.58008 WP_000124693.1.5801 WP_000124693.1.58040 WP_000124693.1.58041 WP_000124693.1.58044 WP_000124693.1.58081 WP_000124693.1.5809 WP_000124693.1.58090 WP_000124693.1.58131 WP_000124693.1.58132 WP_000124693.1.58144 WP_000124693.1.58153 WP_000124693.1.58157 WP_000124693.1.58173 WP_000124693.1.58191 WP_000124693.1.58194 WP_000124693.1.58239 WP_000124693.1.58249 WP_000124693.1.58251 WP_000124693.1.58252 WP_000124693.1.58261 WP_000124693.1.58274 WP_000124693.1.5828 WP_000124693.1.58282 WP_000124693.1.58290 WP_000124693.1.58301 WP_000124693.1.58324 WP_000124693.1.58326 WP_000124693.1.58334 WP_000124693.1.58357 WP_000124693.1.58358 WP_000124693.1.5836 WP_000124693.1.58372 WP_000124693.1.58407 WP_000124693.1.58416 WP_000124693.1.58418 WP_000124693.1.58442 WP_000124693.1.58443 WP_000124693.1.58451 WP_000124693.1.5846 WP_000124693.1.58467 WP_000124693.1.58485 WP_000124693.1.58486 WP_000124693.1.58489 WP_000124693.1.58537 WP_000124693.1.5854 WP_000124693.1.58548 WP_000124693.1.58564 WP_000124693.1.58568 WP_000124693.1.5858 WP_000124693.1.58583 WP_000124693.1.58633 WP_000124693.1.58652 WP_000124693.1.58662 WP_000124693.1.58663 WP_000124693.1.58669 WP_000124693.1.58675 WP_000124693.1.58698 WP_000124693.1.587 WP_000124693.1.58724 WP_000124693.1.58729 WP_000124693.1.58744 WP_000124693.1.58745 WP_000124693.1.58749 WP_000124693.1.5875 WP_000124693.1.5878 WP_000124693.1.58796 WP_000124693.1.58803 WP_000124693.1.58807 WP_000124693.1.58831 WP_000124693.1.58834 WP_000124693.1.58836 WP_000124693.1.58847 WP_000124693.1.5886 WP_000124693.1.58861 WP_000124693.1.58883 WP_000124693.1.58884 WP_000124693.1.58898 WP_000124693.1.58926 WP_000124693.1.58932 WP_000124693.1.58949 WP_000124693.1.58963 WP_000124693.1.58970 WP_000124693.1.58974 WP_000124693.1.59006 WP_000124693.1.59012 WP_000124693.1.59020 WP_000124693.1.59043 WP_000124693.1.59056 WP_000124693.1.59061 WP_000124693.1.59064 WP_000124693.1.59068 WP_000124693.1.59084 WP_000124693.1.59094 WP_000124693.1.59097 WP_000124693.1.59125 WP_000124693.1.59136 WP_000124693.1.59142 WP_000124693.1.59148 WP_000124693.1.59163 WP_000124693.1.59224 WP_000124693.1.59236 WP_000124693.1.59276 WP_000124693.1.59282 WP_000124693.1.5929 WP_000124693.1.59294 WP_000124693.1.59295 WP_000124693.1.59299 WP_000124693.1.59313 WP_000124693.1.59321 WP_000124693.1.59335 WP_000124693.1.59336 WP_000124693.1.59375 WP_000124693.1.59381 WP_000124693.1.59412 WP_000124693.1.59420 WP_000124693.1.59427 WP_000124693.1.59439 WP_000124693.1.59458 WP_000124693.1.59486 WP_000124693.1.5949 WP_000124693.1.59490 WP_000124693.1.59501 WP_000124693.1.59508 WP_000124693.1.59510 WP_000124693.1.59512 WP_000124693.1.59521 WP_000124693.1.5953 WP_000124693.1.59538 WP_000124693.1.59548 WP_000124693.1.59562 WP_000124693.1.59587 WP_000124693.1.59604 WP_000124693.1.59636 WP_000124693.1.59641 WP_000124693.1.59646 WP_000124693.1.59648 WP_000124693.1.59684 WP_000124693.1.5969 WP_000124693.1.59694 WP_000124693.1.59709 WP_000124693.1.59710 WP_000124693.1.59751 WP_000124693.1.59755 WP_000124693.1.59771 WP_000124693.1.5979 WP_000124693.1.59827 WP_000124693.1.59829 WP_000124693.1.59830 WP_000124693.1.59847 WP_000124693.1.59848 WP_000124693.1.59863 WP_000124693.1.59928 WP_000124693.1.5993 WP_000124693.1.59933 WP_000124693.1.59953 WP_000124693.1.59969 WP_000124693.1.59979 WP_000124693.1.59994 WP_000124693.1.60004 WP_000124693.1.60008 WP_000124693.1.60015 WP_000124693.1.60021 WP_000124693.1.60045 WP_000124693.1.60052 WP_000124693.1.60069 WP_000124693.1.60076 WP_000124693.1.60114 WP_000124693.1.60126 WP_000124693.1.60137 WP_000124693.1.60140 WP_000124693.1.60154 WP_000124693.1.60155 WP_000124693.1.60168 WP_000124693.1.60192 WP_000124693.1.60199 WP_000124693.1.60209 WP_000124693.1.60212 WP_000124693.1.60213 WP_000124693.1.60226 WP_000124693.1.60231 WP_000124693.1.60253 WP_000124693.1.60285 WP_000124693.1.60320 WP_000124693.1.60322 WP_000124693.1.60324 WP_000124693.1.6033 WP_000124693.1.60330 WP_000124693.1.60356 WP_000124693.1.60370 WP_000124693.1.60379 WP_000124693.1.6038 WP_000124693.1.60380 WP_000124693.1.6041 WP_000124693.1.60424 WP_000124693.1.60425 WP_000124693.1.60464 WP_000124693.1.60469 WP_000124693.1.60481 WP_000124693.1.60486 WP_000124693.1.605 WP_000124693.1.60503 WP_000124693.1.60507 WP_000124693.1.6052 WP_000124693.1.60545 WP_000124693.1.60560 WP_000124693.1.60561 WP_000124693.1.6058 WP_000124693.1.60584 WP_000124693.1.60597 WP_000124693.1.6060 WP_000124693.1.60608 WP_000124693.1.60622 WP_000124693.1.60643 WP_000124693.1.60661 WP_000124693.1.60676 WP_000124693.1.60708 WP_000124693.1.60713 WP_000124693.1.60725 WP_000124693.1.60746 WP_000124693.1.60760 WP_000124693.1.60772 WP_000124693.1.60783 WP_000124693.1.60792 WP_000124693.1.60794 WP_000124693.1.608 WP_000124693.1.60807 WP_000124693.1.60809 WP_000124693.1.60838 WP_000124693.1.60851 WP_000124693.1.60855 WP_000124693.1.60857 WP_000124693.1.6086 WP_000124693.1.60863 WP_000124693.1.60866 WP_000124693.1.60874 WP_000124693.1.60882 WP_000124693.1.60889 WP_000124693.1.60897 WP_000124693.1.6090 WP_000124693.1.60919 WP_000124693.1.60926 WP_000124693.1.60941 WP_000124693.1.60950 WP_000124693.1.60976 WP_000124693.1.60988 WP_000124693.1.60990 WP_000124693.1.6104 WP_000124693.1.61044 WP_000124693.1.61045 WP_000124693.1.61076 WP_000124693.1.61078 WP_000124693.1.6108 WP_000124693.1.61087 WP_000124693.1.61114 WP_000124693.1.61123 WP_000124693.1.6114 WP_000124693.1.61146 WP_000124693.1.61147 WP_000124693.1.61168 WP_000124693.1.61184 WP_000124693.1.61200 WP_000124693.1.61201 WP_000124693.1.61210 WP_000124693.1.61218 WP_000124693.1.61232 WP_000124693.1.61233 WP_000124693.1.6129 WP_000124693.1.61296 WP_000124693.1.61309 WP_000124693.1.61345 WP_000124693.1.61356 WP_000124693.1.61357 WP_000124693.1.61381 WP_000124693.1.61417 WP_000124693.1.6143 WP_000124693.1.61434 WP_000124693.1.61497 WP_000124693.1.61501 WP_000124693.1.61509 WP_000124693.1.61511 WP_000124693.1.61519 WP_000124693.1.61539 WP_000124693.1.61542 WP_000124693.1.61553 WP_000124693.1.61574 WP_000124693.1.61582 WP_000124693.1.61594 WP_000124693.1.61595 WP_000124693.1.61609 WP_000124693.1.6164 WP_000124693.1.61649 WP_000124693.1.61652 WP_000124693.1.61662 WP_000124693.1.61667 WP_000124693.1.61671 WP_000124693.1.61694 WP_000124693.1.61697 WP_000124693.1.61712 WP_000124693.1.61714 WP_000124693.1.61730 WP_000124693.1.61732 WP_000124693.1.61737 WP_000124693.1.61743 WP_000124693.1.61783 WP_000124693.1.61809 WP_000124693.1.61857 WP_000124693.1.61877 WP_000124693.1.6190 WP_000124693.1.61908 WP_000124693.1.61918 WP_000124693.1.61920 WP_000124693.1.61922 WP_000124693.1.61924 WP_000124693.1.61952 WP_000124693.1.61968 WP_000124693.1.62007 WP_000124693.1.62020 WP_000124693.1.62025 WP_000124693.1.62063 WP_000124693.1.62076 WP_000124693.1.6209 WP_000124693.1.6210 WP_000124693.1.62108 WP_000124693.1.62120 WP_000124693.1.62122 WP_000124693.1.62124 WP_000124693.1.62142 WP_000124693.1.62144 WP_000124693.1.62158 WP_000124693.1.62184 WP_000124693.1.62195 WP_000124693.1.62199 WP_000124693.1.62201 WP_000124693.1.62204 WP_000124693.1.62210 WP_000124693.1.62219 WP_000124693.1.62222 WP_000124693.1.62223 WP_000124693.1.62241 WP_000124693.1.62245 WP_000124693.1.62257 WP_000124693.1.62271 WP_000124693.1.62302 WP_000124693.1.62304 WP_000124693.1.62310 WP_000124693.1.62314 WP_000124693.1.62323 WP_000124693.1.62333 WP_000124693.1.62338 WP_000124693.1.62339 WP_000124693.1.62344 WP_000124693.1.62361 WP_000124693.1.62364 WP_000124693.1.62374 WP_000124693.1.62380 WP_000124693.1.62403 WP_000124693.1.62411 WP_000124693.1.62412 WP_000124693.1.62436 WP_000124693.1.62475 WP_000124693.1.62486 WP_000124693.1.62488 WP_000124693.1.62504 WP_000124693.1.62522 WP_000124693.1.6253 WP_000124693.1.62536 WP_000124693.1.62564 WP_000124693.1.62570 WP_000124693.1.62619 WP_000124693.1.62640 WP_000124693.1.62648 WP_000124693.1.62677 WP_000124693.1.62686 WP_000124693.1.62693 WP_000124693.1.627 WP_000124693.1.62725 WP_000124693.1.62745 WP_000124693.1.62751 WP_000124693.1.62757 WP_000124693.1.62798 WP_000124693.1.62825 WP_000124693.1.62828 WP_000124693.1.62853 WP_000124693.1.62903 WP_000124693.1.62910 WP_000124693.1.62913 WP_000124693.1.6292 WP_000124693.1.62932 WP_000124693.1.62955 WP_000124693.1.62960 WP_000124693.1.62976 WP_000124693.1.62983 WP_000124693.1.62988 WP_000124693.1.63016 WP_000124693.1.63025 WP_000124693.1.63043 WP_000124693.1.63045 WP_000124693.1.63063 WP_000124693.1.63069 WP_000124693.1.63087 WP_000124693.1.63102 WP_000124693.1.63118 WP_000124693.1.63129 WP_000124693.1.63135 WP_000124693.1.63150 WP_000124693.1.63155 WP_000124693.1.63169 WP_000124693.1.63181 WP_000124693.1.63186 WP_000124693.1.63203 WP_000124693.1.63229 WP_000124693.1.63234 WP_000124693.1.63243 WP_000124693.1.63250 WP_000124693.1.63256 WP_000124693.1.63290 WP_000124693.1.63297 WP_000124693.1.63358 WP_000124693.1.63382 WP_000124693.1.63422 WP_000124693.1.63432 WP_000124693.1.63448 WP_000124693.1.63455 WP_000124693.1.63461 WP_000124693.1.63479 WP_000124693.1.63497 WP_000124693.1.63499 WP_000124693.1.63509 WP_000124693.1.63513 WP_000124693.1.63514 WP_000124693.1.63525 WP_000124693.1.63529 WP_000124693.1.63532 WP_000124693.1.63568 WP_000124693.1.6357 WP_000124693.1.63577 WP_000124693.1.63583 WP_000124693.1.63585 WP_000124693.1.63592 WP_000124693.1.63603 WP_000124693.1.63633 WP_000124693.1.63663 WP_000124693.1.63664 WP_000124693.1.6367 WP_000124693.1.63677 WP_000124693.1.63690 WP_000124693.1.6370 WP_000124693.1.63718 WP_000124693.1.63731 WP_000124693.1.63736 WP_000124693.1.63748 WP_000124693.1.6375 WP_000124693.1.63757 WP_000124693.1.63766 WP_000124693.1.63781 WP_000124693.1.63782 WP_000124693.1.63797 WP_000124693.1.63816 WP_000124693.1.63824 WP_000124693.1.63831 WP_000124693.1.63834 WP_000124693.1.63851 WP_000124693.1.63860 WP_000124693.1.63863 WP_000124693.1.63864 WP_000124693.1.63866 WP_000124693.1.63876 WP_000124693.1.6389 WP_000124693.1.63901 WP_000124693.1.63903 WP_000124693.1.63912 WP_000124693.1.63934 WP_000124693.1.63955 WP_000124693.1.63958 WP_000124693.1.63963 WP_000124693.1.63977 WP_000124693.1.6399 WP_000124693.1.63992 WP_000124693.1.64007 WP_000124693.1.64010 WP_000124693.1.64018 WP_000124693.1.64032 WP_000124693.1.64034 WP_000124693.1.64036 WP_000124693.1.64046 WP_000124693.1.64072 WP_000124693.1.64085 WP_000124693.1.64087 WP_000124693.1.64109 WP_000124693.1.64121 WP_000124693.1.6415 WP_000124693.1.64157 WP_000124693.1.64208 WP_000124693.1.64217 WP_000124693.1.64229 WP_000124693.1.6423 WP_000124693.1.64242 WP_000124693.1.64244 WP_000124693.1.64266 WP_000124693.1.64293 WP_000124693.1.64294 WP_000124693.1.64332 WP_000124693.1.64350 WP_000124693.1.6437 WP_000124693.1.64374 WP_000124693.1.64376 WP_000124693.1.64385 WP_000124693.1.64387 WP_000124693.1.64389 WP_000124693.1.644 WP_000124693.1.64403 WP_000124693.1.64462 WP_000124693.1.64471 WP_000124693.1.64500 WP_000124693.1.64501 WP_000124693.1.6451 WP_000124693.1.64538 WP_000124693.1.64569 WP_000124693.1.64597 WP_000124693.1.64632 WP_000124693.1.64645 WP_000124693.1.64648 WP_000124693.1.64649 WP_000124693.1.64654 WP_000124693.1.64662 WP_000124693.1.64663 WP_000124693.1.64667 WP_000124693.1.64674 WP_000124693.1.64690 WP_000124693.1.64702 WP_000124693.1.64709 WP_000124693.1.64710 WP_000124693.1.64711 WP_000124693.1.64715 WP_000124693.1.64744 WP_000124693.1.64757 WP_000124693.1.64758 WP_000124693.1.64763 WP_000124693.1.64771 WP_000124693.1.64781 WP_000124693.1.64798 WP_000124693.1.64817 WP_000124693.1.64831 WP_000124693.1.64847 WP_000124693.1.6487 WP_000124693.1.6489 WP_000124693.1.64891 WP_000124693.1.64894 WP_000124693.1.64919 WP_000124693.1.64920 WP_000124693.1.64944 WP_000124693.1.64972 WP_000124693.1.64974 WP_000124693.1.64977 WP_000124693.1.65011 WP_000124693.1.65016 WP_000124693.1.65018 WP_000124693.1.65022 WP_000124693.1.65027 WP_000124693.1.65028 WP_000124693.1.65052 WP_000124693.1.65054 WP_000124693.1.65075 WP_000124693.1.6514 WP_000124693.1.65163 WP_000124693.1.65168 WP_000124693.1.65171 WP_000124693.1.65172 WP_000124693.1.65185 WP_000124693.1.65191 WP_000124693.1.65200 WP_000124693.1.65211 WP_000124693.1.65218 WP_000124693.1.65226 WP_000124693.1.65238 WP_000124693.1.65248 WP_000124693.1.65249 WP_000124693.1.6525 WP_000124693.1.65266 WP_000124693.1.65269 WP_000124693.1.65295 WP_000124693.1.65308 WP_000124693.1.65348 WP_000124693.1.6535 WP_000124693.1.65357 WP_000124693.1.65363 WP_000124693.1.65394 WP_000124693.1.65395 WP_000124693.1.65437 WP_000124693.1.65459 WP_000124693.1.65463 WP_000124693.1.65474 WP_000124693.1.65475 WP_000124693.1.65487 WP_000124693.1.6549 WP_000124693.1.65499 WP_000124693.1.6550 WP_000124693.1.65508 WP_000124693.1.65538 WP_000124693.1.6554 WP_000124693.1.65558 WP_000124693.1.65572 WP_000124693.1.6560 WP_000124693.1.65601 WP_000124693.1.6561 WP_000124693.1.65633 WP_000124693.1.6565 WP_000124693.1.65650 WP_000124693.1.65687 WP_000124693.1.65696 WP_000124693.1.65697 WP_000124693.1.65698 WP_000124693.1.65699 WP_000124693.1.6572 WP_000124693.1.65737 WP_000124693.1.6575 WP_000124693.1.65755 WP_000124693.1.65771 WP_000124693.1.65782 WP_000124693.1.65790 WP_000124693.1.65795 WP_000124693.1.65812 WP_000124693.1.65818 WP_000124693.1.65838 WP_000124693.1.65846 WP_000124693.1.65849 WP_000124693.1.65863 WP_000124693.1.65876 WP_000124693.1.65881 WP_000124693.1.65883 WP_000124693.1.65901 WP_000124693.1.6594 WP_000124693.1.65940 WP_000124693.1.65945 WP_000124693.1.6595 WP_000124693.1.65956 WP_000124693.1.65968 WP_000124693.1.65985 WP_000124693.1.66021 WP_000124693.1.66031 WP_000124693.1.66049 WP_000124693.1.66052 WP_000124693.1.66064 WP_000124693.1.66074 WP_000124693.1.66082 WP_000124693.1.66085 WP_000124693.1.66109 WP_000124693.1.66122 WP_000124693.1.66129 WP_000124693.1.66145 WP_000124693.1.66167 WP_000124693.1.66171 WP_000124693.1.66183 WP_000124693.1.6620 WP_000124693.1.66216 WP_000124693.1.66234 WP_000124693.1.66235 WP_000124693.1.66250 WP_000124693.1.66270 WP_000124693.1.66272 WP_000124693.1.66273 WP_000124693.1.66289 WP_000124693.1.6630 WP_000124693.1.66314 WP_000124693.1.66315 WP_000124693.1.66324 WP_000124693.1.66330 WP_000124693.1.6634 WP_000124693.1.66358 WP_000124693.1.66361 WP_000124693.1.66362 WP_000124693.1.66365 WP_000124693.1.66368 WP_000124693.1.6638 WP_000124693.1.66385 WP_000124693.1.6640 WP_000124693.1.66400 WP_000124693.1.66428 WP_000124693.1.66446 WP_000124693.1.66462 WP_000124693.1.6647 WP_000124693.1.66480 WP_000124693.1.66492 WP_000124693.1.66506 WP_000124693.1.66534 WP_000124693.1.66539 WP_000124693.1.66600 WP_000124693.1.66630 WP_000124693.1.66665 WP_000124693.1.66678 WP_000124693.1.66681 WP_000124693.1.66684 WP_000124693.1.66698 WP_000124693.1.66702 WP_000124693.1.66733 WP_000124693.1.66755 WP_000124693.1.66759 WP_000124693.1.66779 WP_000124693.1.6680 WP_000124693.1.66800 WP_000124693.1.66801 WP_000124693.1.66807 WP_000124693.1.66820 WP_000124693.1.66824 WP_000124693.1.66825 WP_000124693.1.66834 WP_000124693.1.66860 WP_000124693.1.66901 WP_000124693.1.6692 WP_000124693.1.66937 WP_000124693.1.66953 WP_000124693.1.66955 WP_000124693.1.66959 WP_000124693.1.66962 WP_000124693.1.66981 WP_000124693.1.67 WP_000124693.1.67024 WP_000124693.1.67037 WP_000124693.1.67042 WP_000124693.1.67045 WP_000124693.1.67075 WP_000124693.1.6710 WP_000124693.1.67100 WP_000124693.1.67101 WP_000124693.1.67143 WP_000124693.1.67173 WP_000124693.1.67175 WP_000124693.1.67181 WP_000124693.1.67184 WP_000124693.1.67201 WP_000124693.1.67211 WP_000124693.1.67228 WP_000124693.1.67235 WP_000124693.1.67237 WP_000124693.1.67268 WP_000124693.1.67279 WP_000124693.1.67288 WP_000124693.1.67336 WP_000124693.1.67339 WP_000124693.1.67347 WP_000124693.1.67374 WP_000124693.1.67387 WP_000124693.1.67394 WP_000124693.1.67397 WP_000124693.1.67403 WP_000124693.1.67405 WP_000124693.1.67424 WP_000124693.1.67430 WP_000124693.1.67442 WP_000124693.1.67465 WP_000124693.1.67539 WP_000124693.1.67552 WP_000124693.1.67556 WP_000124693.1.67576 WP_000124693.1.6760 WP_000124693.1.67603 WP_000124693.1.67604 WP_000124693.1.67617 WP_000124693.1.67619 WP_000124693.1.67625 WP_000124693.1.67627 WP_000124693.1.67633 WP_000124693.1.67637 WP_000124693.1.67641 WP_000124693.1.67657 WP_000124693.1.67673 WP_000124693.1.67682 WP_000124693.1.67700 WP_000124693.1.67707 WP_000124693.1.67718 WP_000124693.1.67729 WP_000124693.1.67731 WP_000124693.1.67772 WP_000124693.1.67774 WP_000124693.1.67776 WP_000124693.1.67803 WP_000124693.1.67814 WP_000124693.1.6782 WP_000124693.1.67820 WP_000124693.1.67825 WP_000124693.1.67827 WP_000124693.1.67829 WP_000124693.1.6785 WP_000124693.1.67887 WP_000124693.1.67905 WP_000124693.1.67910 WP_000124693.1.67924 WP_000124693.1.67932 WP_000124693.1.67942 WP_000124693.1.67954 WP_000124693.1.67969 WP_000124693.1.67970 WP_000124693.1.67988 WP_000124693.1.68 WP_000124693.1.68036 WP_000124693.1.68043 WP_000124693.1.68073 WP_000124693.1.68075 WP_000124693.1.6809 WP_000124693.1.68105 WP_000124693.1.68113 WP_000124693.1.68115 WP_000124693.1.68131 WP_000124693.1.68140 WP_000124693.1.68147 WP_000124693.1.68159 WP_000124693.1.68182 WP_000124693.1.6819 WP_000124693.1.68201 WP_000124693.1.68206 WP_000124693.1.6827 WP_000124693.1.68275 WP_000124693.1.68285 WP_000124693.1.6833 WP_000124693.1.68359 WP_000124693.1.68401 WP_000124693.1.68420 WP_000124693.1.68477 WP_000124693.1.68478 WP_000124693.1.6849 WP_000124693.1.685 WP_000124693.1.68514 WP_000124693.1.68532 WP_000124693.1.68547 WP_000124693.1.68564 WP_000124693.1.6857 WP_000124693.1.6858 WP_000124693.1.68589 WP_000124693.1.68591 WP_000124693.1.68629 WP_000124693.1.68652 WP_000124693.1.68655 WP_000124693.1.68656 WP_000124693.1.68658 WP_000124693.1.68677 WP_000124693.1.68688 WP_000124693.1.6869 WP_000124693.1.68690 WP_000124693.1.68742 WP_000124693.1.6875 WP_000124693.1.68770 WP_000124693.1.68778 WP_000124693.1.68787 WP_000124693.1.6879 WP_000124693.1.68809 WP_000124693.1.68816 WP_000124693.1.68818 WP_000124693.1.6882 WP_000124693.1.6883 WP_000124693.1.68893 WP_000124693.1.68894 WP_000124693.1.68895 WP_000124693.1.68914 WP_000124693.1.68928 WP_000124693.1.68958 WP_000124693.1.68966 WP_000124693.1.68975 WP_000124693.1.68999 WP_000124693.1.69001 WP_000124693.1.69006 WP_000124693.1.69011 WP_000124693.1.69029 WP_000124693.1.6904 WP_000124693.1.6905 WP_000124693.1.69053 WP_000124693.1.69058 WP_000124693.1.6907 WP_000124693.1.69080 WP_000124693.1.69086 WP_000124693.1.6913 WP_000124693.1.69131 WP_000124693.1.69139 WP_000124693.1.69146 WP_000124693.1.69151 WP_000124693.1.69170 WP_000124693.1.69210 WP_000124693.1.69236 WP_000124693.1.69255 WP_000124693.1.69270 WP_000124693.1.69273 WP_000124693.1.69282 WP_000124693.1.69288 WP_000124693.1.69296 WP_000124693.1.69320 WP_000124693.1.69346 WP_000124693.1.69359 WP_000124693.1.69371 WP_000124693.1.69376 WP_000124693.1.69385 WP_000124693.1.69396 WP_000124693.1.69397 WP_000124693.1.69433 WP_000124693.1.69465 WP_000124693.1.69466 WP_000124693.1.69485 WP_000124693.1.69515 WP_000124693.1.6954 WP_000124693.1.69554 WP_000124693.1.69564 WP_000124693.1.69575 WP_000124693.1.69588 WP_000124693.1.69592 WP_000124693.1.69597 WP_000124693.1.69611 WP_000124693.1.69616 WP_000124693.1.69636 WP_000124693.1.69642 WP_000124693.1.69644 WP_000124693.1.69656 WP_000124693.1.69657 WP_000124693.1.69690 WP_000124693.1.69696 WP_000124693.1.69704 WP_000124693.1.69710 WP_000124693.1.69754 WP_000124693.1.69758 WP_000124693.1.69760 WP_000124693.1.69767 WP_000124693.1.69785 WP_000124693.1.69787 WP_000124693.1.69790 WP_000124693.1.69807 WP_000124693.1.69808 WP_000124693.1.69817 WP_000124693.1.69839 WP_000124693.1.69848 WP_000124693.1.69890 WP_000124693.1.69923 WP_000124693.1.69948 WP_000124693.1.69953 WP_000124693.1.69965 WP_000124693.1.69975 WP_000124693.1.69977 WP_000124693.1.69982 WP_000124693.1.70003 WP_000124693.1.70010 WP_000124693.1.70028 WP_000124693.1.70047 WP_000124693.1.70049 WP_000124693.1.70058 WP_000124693.1.70061 WP_000124693.1.70087 WP_000124693.1.70088 WP_000124693.1.7010 WP_000124693.1.7014 WP_000124693.1.7016 WP_000124693.1.70169 WP_000124693.1.70183 WP_000124693.1.70205 WP_000124693.1.7021 WP_000124693.1.70240 WP_000124693.1.70241 WP_000124693.1.70248 WP_000124693.1.70249 WP_000124693.1.70261 WP_000124693.1.70262 WP_000124693.1.70269 WP_000124693.1.70272 WP_000124693.1.70281 WP_000124693.1.70289 WP_000124693.1.70290 WP_000124693.1.70303 WP_000124693.1.70314 WP_000124693.1.70321 WP_000124693.1.70326 WP_000124693.1.70327 WP_000124693.1.7033 WP_000124693.1.70355 WP_000124693.1.70427 WP_000124693.1.70433 WP_000124693.1.7044 WP_000124693.1.70440 WP_000124693.1.70447 WP_000124693.1.70485 WP_000124693.1.70488 WP_000124693.1.70491 WP_000124693.1.70523 WP_000124693.1.70531 WP_000124693.1.70545 WP_000124693.1.70547 WP_000124693.1.7055 WP_000124693.1.70580 WP_000124693.1.70596 WP_000124693.1.7060 WP_000124693.1.70623 WP_000124693.1.70643 WP_000124693.1.70644 WP_000124693.1.70662 WP_000124693.1.70671 WP_000124693.1.70678 WP_000124693.1.70679 WP_000124693.1.70683 WP_000124693.1.70685 WP_000124693.1.70692 WP_000124693.1.70708 WP_000124693.1.70712 WP_000124693.1.70717 WP_000124693.1.70731 WP_000124693.1.70732 WP_000124693.1.70733 WP_000124693.1.70761 WP_000124693.1.70772 WP_000124693.1.70785 WP_000124693.1.70792 WP_000124693.1.70797 WP_000124693.1.70837 WP_000124693.1.70845 WP_000124693.1.70846 WP_000124693.1.70869 WP_000124693.1.70883 WP_000124693.1.70899 WP_000124693.1.70914 WP_000124693.1.70922 WP_000124693.1.70929 WP_000124693.1.7093 WP_000124693.1.70948 WP_000124693.1.70959 WP_000124693.1.70969 WP_000124693.1.70971 WP_000124693.1.70977 WP_000124693.1.70981 WP_000124693.1.70985 WP_000124693.1.70986 WP_000124693.1.70995 WP_000124693.1.71007 WP_000124693.1.71010 WP_000124693.1.71023 WP_000124693.1.71039 WP_000124693.1.71057 WP_000124693.1.71069 WP_000124693.1.71081 WP_000124693.1.71088 WP_000124693.1.7110 WP_000124693.1.71116 WP_000124693.1.71117 WP_000124693.1.71120 WP_000124693.1.71146 WP_000124693.1.71150 WP_000124693.1.71165 WP_000124693.1.71171 WP_000124693.1.71172 WP_000124693.1.71184 WP_000124693.1.71186 WP_000124693.1.71188 WP_000124693.1.71201 WP_000124693.1.71202 WP_000124693.1.71243 WP_000124693.1.71248 WP_000124693.1.71268 WP_000124693.1.71299 WP_000124693.1.71305 WP_000124693.1.71306 WP_000124693.1.71337 WP_000124693.1.7134 WP_000124693.1.71363 WP_000124693.1.71368 WP_000124693.1.71378 WP_000124693.1.714 WP_000124693.1.71401 WP_000124693.1.71418 WP_000124693.1.7142 WP_000124693.1.71446 WP_000124693.1.71450 WP_000124693.1.71452 WP_000124693.1.71455 WP_000124693.1.71456 WP_000124693.1.71481 WP_000124693.1.71487 WP_000124693.1.71500 WP_000124693.1.71523 WP_000124693.1.71542 WP_000124693.1.71566 WP_000124693.1.71583 WP_000124693.1.71600 WP_000124693.1.71626 WP_000124693.1.71640 WP_000124693.1.71649 WP_000124693.1.71651 WP_000124693.1.71653 WP_000124693.1.71656 WP_000124693.1.71667 WP_000124693.1.71691 WP_000124693.1.71702 WP_000124693.1.71716 WP_000124693.1.7174 WP_000124693.1.71746 WP_000124693.1.71750 WP_000124693.1.71756 WP_000124693.1.71798 WP_000124693.1.71845 WP_000124693.1.71848 WP_000124693.1.71872 WP_000124693.1.71881 WP_000124693.1.71908 WP_000124693.1.71923 WP_000124693.1.71929 WP_000124693.1.71941 WP_000124693.1.71950 WP_000124693.1.71952 WP_000124693.1.71954 WP_000124693.1.71973 WP_000124693.1.71979 WP_000124693.1.71984 WP_000124693.1.71985 WP_000124693.1.720 WP_000124693.1.72003 WP_000124693.1.72065 WP_000124693.1.72073 WP_000124693.1.72100 WP_000124693.1.72105 WP_000124693.1.72107 WP_000124693.1.72119 WP_000124693.1.72182 WP_000124693.1.72188 WP_000124693.1.72190 WP_000124693.1.72203 WP_000124693.1.72220 WP_000124693.1.72221 WP_000124693.1.72226 WP_000124693.1.72234 WP_000124693.1.72243 WP_000124693.1.72254 WP_000124693.1.72269 WP_000124693.1.72277 WP_000124693.1.72281 WP_000124693.1.72283 WP_000124693.1.72300 WP_000124693.1.72307 WP_000124693.1.72325 WP_000124693.1.72339 WP_000124693.1.72350 WP_000124693.1.72351 WP_000124693.1.72372 WP_000124693.1.72376 WP_000124693.1.72382 WP_000124693.1.72383 WP_000124693.1.72403 WP_000124693.1.72412 WP_000124693.1.7243 WP_000124693.1.72438 WP_000124693.1.72461 WP_000124693.1.72470 WP_000124693.1.72527 WP_000124693.1.72532 WP_000124693.1.7255 WP_000124693.1.72594 WP_000124693.1.72602 WP_000124693.1.72625 WP_000124693.1.72629 WP_000124693.1.72631 WP_000124693.1.72638 WP_000124693.1.72642 WP_000124693.1.72667 WP_000124693.1.72671 WP_000124693.1.72674 WP_000124693.1.72689 WP_000124693.1.72716 WP_000124693.1.72718 WP_000124693.1.72724 WP_000124693.1.72728 WP_000124693.1.72789 WP_000124693.1.72793 WP_000124693.1.72797 WP_000124693.1.72827 WP_000124693.1.72828 WP_000124693.1.72843 WP_000124693.1.72850 WP_000124693.1.72865 WP_000124693.1.72871 WP_000124693.1.72872 WP_000124693.1.72887 WP_000124693.1.72892 WP_000124693.1.72894 WP_000124693.1.72896 WP_000124693.1.72897 WP_000124693.1.72944 WP_000124693.1.72946 WP_000124693.1.7295 WP_000124693.1.72968 WP_000124693.1.72969 WP_000124693.1.72975 WP_000124693.1.72987 WP_000124693.1.7304 WP_000124693.1.73052 WP_000124693.1.73062 WP_000124693.1.73068 WP_000124693.1.73102 WP_000124693.1.7311 WP_000124693.1.73114 WP_000124693.1.73125 WP_000124693.1.73144 WP_000124693.1.7315 WP_000124693.1.7316 WP_000124693.1.73164 WP_000124693.1.73177 WP_000124693.1.73180 WP_000124693.1.73200 WP_000124693.1.73242 WP_000124693.1.73258 WP_000124693.1.73270 WP_000124693.1.73285 WP_000124693.1.7332 WP_000124693.1.73328 WP_000124693.1.7333 WP_000124693.1.7334 WP_000124693.1.73352 WP_000124693.1.73362 WP_000124693.1.73377 WP_000124693.1.73379 WP_000124693.1.73389 WP_000124693.1.7341 WP_000124693.1.73425 WP_000124693.1.73461 WP_000124693.1.73481 WP_000124693.1.73488 WP_000124693.1.73504 WP_000124693.1.73512 WP_000124693.1.7353 WP_000124693.1.73535 WP_000124693.1.73544 WP_000124693.1.7356 WP_000124693.1.73561 WP_000124693.1.73581 WP_000124693.1.73596 WP_000124693.1.73598 WP_000124693.1.7361 WP_000124693.1.73617 WP_000124693.1.73648 WP_000124693.1.73667 WP_000124693.1.73669 WP_000124693.1.73701 WP_000124693.1.73708 WP_000124693.1.7374 WP_000124693.1.73753 WP_000124693.1.73758 WP_000124693.1.73764 WP_000124693.1.73768 WP_000124693.1.73794 WP_000124693.1.73804 WP_000124693.1.73831 WP_000124693.1.73847 WP_000124693.1.73849 WP_000124693.1.7386 WP_000124693.1.7387 WP_000124693.1.73901 WP_000124693.1.73924 WP_000124693.1.73926 WP_000124693.1.7394 WP_000124693.1.73945 WP_000124693.1.73948 WP_000124693.1.73956 WP_000124693.1.73958 WP_000124693.1.73965 WP_000124693.1.73999 WP_000124693.1.74024 WP_000124693.1.74028 WP_000124693.1.74029 WP_000124693.1.74030 WP_000124693.1.74038 WP_000124693.1.74040 WP_000124693.1.74043 WP_000124693.1.7405 WP_000124693.1.74058 WP_000124693.1.74070 WP_000124693.1.74077 WP_000124693.1.74089 WP_000124693.1.74117 WP_000124693.1.74135 WP_000124693.1.74174 WP_000124693.1.74181 WP_000124693.1.74191 WP_000124693.1.74207 WP_000124693.1.74214 WP_000124693.1.74228 WP_000124693.1.74241 WP_000124693.1.74285 WP_000124693.1.743 WP_000124693.1.7430 WP_000124693.1.74300 WP_000124693.1.74317 WP_000124693.1.7433 WP_000124693.1.74379 WP_000124693.1.74402 WP_000124693.1.74410 WP_000124693.1.74414 WP_000124693.1.74415 WP_000124693.1.74418 WP_000124693.1.74422 WP_000124693.1.74428 WP_000124693.1.7444 WP_000124693.1.74454 WP_000124693.1.74469 WP_000124693.1.74481 WP_000124693.1.745 WP_000124693.1.74500 WP_000124693.1.74545 WP_000124693.1.74570 WP_000124693.1.74578 WP_000124693.1.7458 WP_000124693.1.74616 WP_000124693.1.74620 WP_000124693.1.74621 WP_000124693.1.74632 WP_000124693.1.74639 WP_000124693.1.74644 WP_000124693.1.74647 WP_000124693.1.74661 WP_000124693.1.74673 WP_000124693.1.74677 WP_000124693.1.74699 WP_000124693.1.74702 WP_000124693.1.74741 WP_000124693.1.74745 WP_000124693.1.74757 WP_000124693.1.74806 WP_000124693.1.74807 WP_000124693.1.74826 WP_000124693.1.74831 WP_000124693.1.74876 WP_000124693.1.74884 WP_000124693.1.74894 WP_000124693.1.7491 WP_000124693.1.74929 WP_000124693.1.74939 WP_000124693.1.74946 WP_000124693.1.74972 WP_000124693.1.74973 WP_000124693.1.74992 WP_000124693.1.74996 WP_000124693.1.75009 WP_000124693.1.75051 WP_000124693.1.75056 WP_000124693.1.75058 WP_000124693.1.7507 WP_000124693.1.75089 WP_000124693.1.75114 WP_000124693.1.75116 WP_000124693.1.75129 WP_000124693.1.75134 WP_000124693.1.75148 WP_000124693.1.75150 WP_000124693.1.75159 WP_000124693.1.75168 WP_000124693.1.75180 WP_000124693.1.75187 WP_000124693.1.75237 WP_000124693.1.75273 WP_000124693.1.75288 WP_000124693.1.75296 WP_000124693.1.75301 WP_000124693.1.7531 WP_000124693.1.75334 WP_000124693.1.75362 WP_000124693.1.75371 WP_000124693.1.75385 WP_000124693.1.75392 WP_000124693.1.75400 WP_000124693.1.75402 WP_000124693.1.75413 WP_000124693.1.7543 WP_000124693.1.75433 WP_000124693.1.75450 WP_000124693.1.75494 WP_000124693.1.75532 WP_000124693.1.75565 WP_000124693.1.7558 WP_000124693.1.75585 WP_000124693.1.75593 WP_000124693.1.75607 WP_000124693.1.75609 WP_000124693.1.75610 WP_000124693.1.75626 WP_000124693.1.75633 WP_000124693.1.75664 WP_000124693.1.75716 WP_000124693.1.75718 WP_000124693.1.75740 WP_000124693.1.75745 WP_000124693.1.75751 WP_000124693.1.75760 WP_000124693.1.75764 WP_000124693.1.75793 WP_000124693.1.75794 WP_000124693.1.75810 WP_000124693.1.75828 WP_000124693.1.75837 WP_000124693.1.75844 WP_000124693.1.75863 WP_000124693.1.75873 WP_000124693.1.75874 WP_000124693.1.75884 WP_000124693.1.75886 WP_000124693.1.75898 WP_000124693.1.75902 WP_000124693.1.75932 WP_000124693.1.75945 WP_000124693.1.75957 WP_000124693.1.76 WP_000124693.1.76020 WP_000124693.1.76024 WP_000124693.1.76055 WP_000124693.1.76081 WP_000124693.1.76097 WP_000124693.1.76102 WP_000124693.1.76108 WP_000124693.1.76115 WP_000124693.1.76116 WP_000124693.1.76122 WP_000124693.1.76137 WP_000124693.1.76156 WP_000124693.1.76162 WP_000124693.1.76164 WP_000124693.1.76170 WP_000124693.1.76186 WP_000124693.1.76197 WP_000124693.1.76208 WP_000124693.1.76252 WP_000124693.1.76256 WP_000124693.1.7629 WP_000124693.1.76301 WP_000124693.1.76327 WP_000124693.1.76339 WP_000124693.1.7634 WP_000124693.1.76345 WP_000124693.1.76346 WP_000124693.1.76364 WP_000124693.1.76366 WP_000124693.1.76417 WP_000124693.1.76434 WP_000124693.1.76445 WP_000124693.1.76451 WP_000124693.1.7646 WP_000124693.1.76471 WP_000124693.1.76495 WP_000124693.1.76510 WP_000124693.1.76529 WP_000124693.1.76532 WP_000124693.1.76548 WP_000124693.1.7655 WP_000124693.1.76558 WP_000124693.1.7657 WP_000124693.1.76572 WP_000124693.1.76576 WP_000124693.1.7660 WP_000124693.1.76611 WP_000124693.1.76641 WP_000124693.1.76651 WP_000124693.1.76653 WP_000124693.1.76673 WP_000124693.1.76706 WP_000124693.1.7672 WP_000124693.1.76721 WP_000124693.1.76724 WP_000124693.1.76738 WP_000124693.1.76756 WP_000124693.1.76760 WP_000124693.1.76776 WP_000124693.1.76788 WP_000124693.1.76799 WP_000124693.1.76806 WP_000124693.1.7684 WP_000124693.1.76854 WP_000124693.1.76866 WP_000124693.1.76875 WP_000124693.1.76880 WP_000124693.1.76899 WP_000124693.1.76913 WP_000124693.1.76916 WP_000124693.1.76932 WP_000124693.1.76968 WP_000124693.1.76973 WP_000124693.1.76988 WP_000124693.1.77016 WP_000124693.1.77017 WP_000124693.1.77033 WP_000124693.1.77038 WP_000124693.1.77047 WP_000124693.1.77067 WP_000124693.1.77080 WP_000124693.1.77087 WP_000124693.1.77090 WP_000124693.1.77111 WP_000124693.1.7712 WP_000124693.1.77177 WP_000124693.1.77180 WP_000124693.1.77184 WP_000124693.1.77193 WP_000124693.1.77241 WP_000124693.1.77244 WP_000124693.1.77267 WP_000124693.1.77271 WP_000124693.1.77292 WP_000124693.1.77299 WP_000124693.1.77306 WP_000124693.1.77313 WP_000124693.1.77349 WP_000124693.1.77356 WP_000124693.1.77384 WP_000124693.1.77390 WP_000124693.1.77414 WP_000124693.1.77431 WP_000124693.1.77436 WP_000124693.1.77440 WP_000124693.1.77475 WP_000124693.1.77501 WP_000124693.1.77512 WP_000124693.1.77513 WP_000124693.1.77514 WP_000124693.1.77529 WP_000124693.1.77543 WP_000124693.1.77549 WP_000124693.1.77555 WP_000124693.1.77563 WP_000124693.1.77565 WP_000124693.1.77575 WP_000124693.1.77596 WP_000124693.1.77629 WP_000124693.1.77646 WP_000124693.1.77653 WP_000124693.1.77692 WP_000124693.1.77702 WP_000124693.1.77710 WP_000124693.1.77713 WP_000124693.1.7772 WP_000124693.1.77729 WP_000124693.1.77754 WP_000124693.1.77761 WP_000124693.1.7782 WP_000124693.1.77825 WP_000124693.1.77837 WP_000124693.1.77846 WP_000124693.1.77851 WP_000124693.1.77861 WP_000124693.1.77871 WP_000124693.1.77898 WP_000124693.1.77900 WP_000124693.1.77918 WP_000124693.1.7792 WP_000124693.1.77923 WP_000124693.1.7793 WP_000124693.1.77951 WP_000124693.1.77960 WP_000124693.1.77971 WP_000124693.1.77975 WP_000124693.1.77983 WP_000124693.1.77989 WP_000124693.1.78 WP_000124693.1.78016 WP_000124693.1.7802 WP_000124693.1.78026 WP_000124693.1.78033 WP_000124693.1.78035 WP_000124693.1.78048 WP_000124693.1.78051 WP_000124693.1.78053 WP_000124693.1.78076 WP_000124693.1.78096 WP_000124693.1.78100 WP_000124693.1.78107 WP_000124693.1.78110 WP_000124693.1.78120 WP_000124693.1.7814 WP_000124693.1.78166 WP_000124693.1.78168 WP_000124693.1.78170 WP_000124693.1.78180 WP_000124693.1.78192 WP_000124693.1.78195 WP_000124693.1.78201 WP_000124693.1.78245 WP_000124693.1.78259 WP_000124693.1.78291 WP_000124693.1.78301 WP_000124693.1.78309 WP_000124693.1.78320 WP_000124693.1.78339 WP_000124693.1.78352 WP_000124693.1.78372 WP_000124693.1.78382 WP_000124693.1.78383 WP_000124693.1.78388 WP_000124693.1.78407 WP_000124693.1.78410 WP_000124693.1.78443 WP_000124693.1.78495 WP_000124693.1.78496 WP_000124693.1.78501 WP_000124693.1.78502 WP_000124693.1.78602 WP_000124693.1.78603 WP_000124693.1.7861 WP_000124693.1.78618 WP_000124693.1.7862 WP_000124693.1.78626 WP_000124693.1.78632 WP_000124693.1.78658 WP_000124693.1.78661 WP_000124693.1.78673 WP_000124693.1.78674 WP_000124693.1.78676 WP_000124693.1.78697 WP_000124693.1.78715 WP_000124693.1.78734 WP_000124693.1.78735 WP_000124693.1.78738 WP_000124693.1.78761 WP_000124693.1.7877 WP_000124693.1.78771 WP_000124693.1.78789 WP_000124693.1.78802 WP_000124693.1.78815 WP_000124693.1.78830 WP_000124693.1.78835 WP_000124693.1.78838 WP_000124693.1.78862 WP_000124693.1.78871 WP_000124693.1.78874 WP_000124693.1.78877 WP_000124693.1.78881 WP_000124693.1.78896 WP_000124693.1.789 WP_000124693.1.7891 WP_000124693.1.78913 WP_000124693.1.78918 WP_000124693.1.78928 WP_000124693.1.7893 WP_000124693.1.78930 WP_000124693.1.78951 WP_000124693.1.78959 WP_000124693.1.78993 WP_000124693.1.79011 WP_000124693.1.79012 WP_000124693.1.79032 WP_000124693.1.79069 WP_000124693.1.79074 WP_000124693.1.79081 WP_000124693.1.79098 WP_000124693.1.79099 WP_000124693.1.79140 WP_000124693.1.79151 WP_000124693.1.79155 WP_000124693.1.79164 WP_000124693.1.79167 WP_000124693.1.79189 WP_000124693.1.79203 WP_000124693.1.79204 WP_000124693.1.79235 WP_000124693.1.79280 WP_000124693.1.79289 WP_000124693.1.79297 WP_000124693.1.79302 WP_000124693.1.79335 WP_000124693.1.79370 WP_000124693.1.79397 WP_000124693.1.794 WP_000124693.1.79427 WP_000124693.1.79456 WP_000124693.1.79462 WP_000124693.1.79468 WP_000124693.1.79472 WP_000124693.1.79490 WP_000124693.1.79495 WP_000124693.1.79529 WP_000124693.1.79531 WP_000124693.1.79532 WP_000124693.1.79547 WP_000124693.1.7956 WP_000124693.1.79570 WP_000124693.1.79580 WP_000124693.1.79586 WP_000124693.1.79635 WP_000124693.1.7964 WP_000124693.1.79642 WP_000124693.1.79645 WP_000124693.1.79654 WP_000124693.1.79659 WP_000124693.1.79668 WP_000124693.1.7970 WP_000124693.1.79708 WP_000124693.1.7972 WP_000124693.1.79722 WP_000124693.1.79734 WP_000124693.1.79738 WP_000124693.1.79757 WP_000124693.1.79772 WP_000124693.1.79778 WP_000124693.1.7979 WP_000124693.1.7982 WP_000124693.1.79832 WP_000124693.1.79845 WP_000124693.1.79867 WP_000124693.1.79880 WP_000124693.1.79892 WP_000124693.1.7991 WP_000124693.1.79910 WP_000124693.1.79914 WP_000124693.1.79916 WP_000124693.1.79929 WP_000124693.1.79934 WP_000124693.1.7994 WP_000124693.1.79942 WP_000124693.1.79945 WP_000124693.1.79951 WP_000124693.1.79966 WP_000124693.1.79974 WP_000124693.1.79977 WP_000124693.1.79996 WP_000124693.1.80045 WP_000124693.1.80065 WP_000124693.1.80077 WP_000124693.1.80103 WP_000124693.1.80137 WP_000124693.1.80149 WP_000124693.1.80182 WP_000124693.1.80229 WP_000124693.1.80236 WP_000124693.1.8024 WP_000124693.1.80249 WP_000124693.1.80250 WP_000124693.1.80254 WP_000124693.1.80273 WP_000124693.1.80282 WP_000124693.1.80293 WP_000124693.1.80296 WP_000124693.1.80307 WP_000124693.1.80333 WP_000124693.1.80354 WP_000124693.1.80363 WP_000124693.1.80366 WP_000124693.1.80368 WP_000124693.1.80380 WP_000124693.1.80386 WP_000124693.1.80400 WP_000124693.1.80441 WP_000124693.1.80443 WP_000124693.1.80462 WP_000124693.1.80473 WP_000124693.1.80479 WP_000124693.1.80480 WP_000124693.1.8049 WP_000124693.1.80492 WP_000124693.1.80496 WP_000124693.1.80529 WP_000124693.1.80542 WP_000124693.1.80569 WP_000124693.1.80586 WP_000124693.1.80609 WP_000124693.1.80629 WP_000124693.1.80638 WP_000124693.1.80651 WP_000124693.1.80664 WP_000124693.1.80667 WP_000124693.1.80674 WP_000124693.1.80696 WP_000124693.1.80707 WP_000124693.1.80723 WP_000124693.1.80725 WP_000124693.1.80741 WP_000124693.1.80750 WP_000124693.1.80757 WP_000124693.1.80760 WP_000124693.1.80780 WP_000124693.1.80803 WP_000124693.1.80819 WP_000124693.1.80827 WP_000124693.1.80831 WP_000124693.1.80840 WP_000124693.1.80850 WP_000124693.1.80857 WP_000124693.1.80868 WP_000124693.1.80874 WP_000124693.1.80876 WP_000124693.1.80881 WP_000124693.1.80913 WP_000124693.1.80927 WP_000124693.1.80939 WP_000124693.1.80959 WP_000124693.1.8096 WP_000124693.1.80973 WP_000124693.1.80984 WP_000124693.1.81037 WP_000124693.1.81041 WP_000124693.1.8106 WP_000124693.1.81062 WP_000124693.1.81067 WP_000124693.1.81069 WP_000124693.1.81084 WP_000124693.1.81107 WP_000124693.1.81109 WP_000124693.1.81110 WP_000124693.1.81118 WP_000124693.1.81131 WP_000124693.1.81149 WP_000124693.1.81175 WP_000124693.1.81187 WP_000124693.1.8119 WP_000124693.1.81193 WP_000124693.1.81197 WP_000124693.1.81225 WP_000124693.1.81262 WP_000124693.1.81268 WP_000124693.1.81269 WP_000124693.1.8127 WP_000124693.1.81271 WP_000124693.1.81275 WP_000124693.1.8130 WP_000124693.1.81302 WP_000124693.1.81305 WP_000124693.1.8131 WP_000124693.1.81320 WP_000124693.1.81321 WP_000124693.1.81328 WP_000124693.1.81333 WP_000124693.1.8134 WP_000124693.1.81342 WP_000124693.1.81354 WP_000124693.1.81364 WP_000124693.1.81388 WP_000124693.1.81404 WP_000124693.1.81409 WP_000124693.1.81410 WP_000124693.1.81425 WP_000124693.1.81455 WP_000124693.1.81472 WP_000124693.1.81494 WP_000124693.1.81504 WP_000124693.1.81528 WP_000124693.1.81548 WP_000124693.1.81557 WP_000124693.1.81568 WP_000124693.1.81612 WP_000124693.1.81667 WP_000124693.1.81668 WP_000124693.1.81676 WP_000124693.1.8168 WP_000124693.1.81681 WP_000124693.1.8170 WP_000124693.1.81727 WP_000124693.1.81735 WP_000124693.1.81736 WP_000124693.1.81743 WP_000124693.1.81746 WP_000124693.1.81750 WP_000124693.1.81760 WP_000124693.1.81763 WP_000124693.1.81768 WP_000124693.1.81785 WP_000124693.1.81795 WP_000124693.1.81798 WP_000124693.1.81855 WP_000124693.1.81902 WP_000124693.1.81921 WP_000124693.1.81931 WP_000124693.1.81936 WP_000124693.1.81941 WP_000124693.1.81949 WP_000124693.1.8196 WP_000124693.1.81965 WP_000124693.1.81974 WP_000124693.1.81977 WP_000124693.1.81995 WP_000124693.1.82037 WP_000124693.1.82070 WP_000124693.1.82076 WP_000124693.1.82099 WP_000124693.1.82131 WP_000124693.1.82141 WP_000124693.1.82144 WP_000124693.1.82149 WP_000124693.1.82156 WP_000124693.1.8218 WP_000124693.1.82180 WP_000124693.1.82192 WP_000124693.1.82201 WP_000124693.1.82214 WP_000124693.1.82225 WP_000124693.1.82232 WP_000124693.1.82258 WP_000124693.1.82269 WP_000124693.1.82337 WP_000124693.1.82347 WP_000124693.1.82352 WP_000124693.1.8236 WP_000124693.1.82369 WP_000124693.1.82395 WP_000124693.1.8240 WP_000124693.1.82401 WP_000124693.1.82408 WP_000124693.1.82416 WP_000124693.1.8242 WP_000124693.1.82420 WP_000124693.1.82434 WP_000124693.1.82456 WP_000124693.1.82464 WP_000124693.1.82465 WP_000124693.1.8247 WP_000124693.1.82473 WP_000124693.1.82474 WP_000124693.1.82479 WP_000124693.1.82503 WP_000124693.1.82515 WP_000124693.1.82529 WP_000124693.1.82530 WP_000124693.1.82553 WP_000124693.1.82562 WP_000124693.1.82569 WP_000124693.1.82570 WP_000124693.1.82584 WP_000124693.1.82636 WP_000124693.1.82637 WP_000124693.1.82646 WP_000124693.1.82670 WP_000124693.1.82676 WP_000124693.1.82692 WP_000124693.1.82731 WP_000124693.1.82761 WP_000124693.1.82763 WP_000124693.1.82812 WP_000124693.1.8282 WP_000124693.1.82841 WP_000124693.1.82843 WP_000124693.1.82850 WP_000124693.1.82867 WP_000124693.1.82872 WP_000124693.1.82886 WP_000124693.1.82895 WP_000124693.1.82899 WP_000124693.1.82908 WP_000124693.1.82937 WP_000124693.1.8294 WP_000124693.1.82944 WP_000124693.1.82946 WP_000124693.1.82956 WP_000124693.1.82959 WP_000124693.1.82964 WP_000124693.1.82992 WP_000124693.1.83005 WP_000124693.1.83006 WP_000124693.1.83007 WP_000124693.1.8304 WP_000124693.1.83061 WP_000124693.1.83092 WP_000124693.1.83119 WP_000124693.1.83128 WP_000124693.1.83139 WP_000124693.1.83163 WP_000124693.1.83180 WP_000124693.1.83204 WP_000124693.1.8322 WP_000124693.1.83221 WP_000124693.1.83229 WP_000124693.1.83235 WP_000124693.1.83247 WP_000124693.1.83252 WP_000124693.1.83258 WP_000124693.1.83280 WP_000124693.1.83290 WP_000124693.1.83301 WP_000124693.1.83305 WP_000124693.1.83331 WP_000124693.1.83333 WP_000124693.1.83354 WP_000124693.1.83356 WP_000124693.1.83360 WP_000124693.1.83365 WP_000124693.1.83378 WP_000124693.1.83382 WP_000124693.1.83388 WP_000124693.1.83407 WP_000124693.1.83413 WP_000124693.1.83491 WP_000124693.1.83510 WP_000124693.1.83516 WP_000124693.1.83523 WP_000124693.1.8354 WP_000124693.1.83558 WP_000124693.1.83572 WP_000124693.1.83598 WP_000124693.1.83650 WP_000124693.1.83651 WP_000124693.1.83657 WP_000124693.1.83677 WP_000124693.1.83710 WP_000124693.1.83721 WP_000124693.1.83739 WP_000124693.1.8375 WP_000124693.1.83759 WP_000124693.1.83760 WP_000124693.1.83806 WP_000124693.1.83854 WP_000124693.1.83897 WP_000124693.1.83923 WP_000124693.1.83960 WP_000124693.1.83979 WP_000124693.1.8399 WP_000124693.1.83994 WP_000124693.1.83995 WP_000124693.1.84 WP_000124693.1.84000 WP_000124693.1.84001 WP_000124693.1.84011 WP_000124693.1.84031 WP_000124693.1.8406 WP_000124693.1.84075 WP_000124693.1.84076 WP_000124693.1.84077 WP_000124693.1.84083 WP_000124693.1.84086 WP_000124693.1.84100 WP_000124693.1.84103 WP_000124693.1.84106 WP_000124693.1.84110 WP_000124693.1.84115 WP_000124693.1.84127 WP_000124693.1.84150 WP_000124693.1.84154 WP_000124693.1.84168 WP_000124693.1.84179 WP_000124693.1.84198 WP_000124693.1.84205 WP_000124693.1.84209 WP_000124693.1.84229 WP_000124693.1.84230 WP_000124693.1.8425 WP_000124693.1.84252 WP_000124693.1.84283 WP_000124693.1.84291 WP_000124693.1.84300 WP_000124693.1.8431 WP_000124693.1.84325 WP_000124693.1.84345 WP_000124693.1.84355 WP_000124693.1.84359 WP_000124693.1.84369 WP_000124693.1.84373 WP_000124693.1.84392 WP_000124693.1.84397 WP_000124693.1.84401 WP_000124693.1.84403 WP_000124693.1.8441 WP_000124693.1.84435 WP_000124693.1.84459 WP_000124693.1.84461 WP_000124693.1.84475 WP_000124693.1.84497 WP_000124693.1.84515 WP_000124693.1.84523 WP_000124693.1.84532 WP_000124693.1.84551 WP_000124693.1.84554 WP_000124693.1.84567 WP_000124693.1.84572 WP_000124693.1.84598 WP_000124693.1.84631 WP_000124693.1.84644 WP_000124693.1.84659 WP_000124693.1.84683 WP_000124693.1.84693 WP_000124693.1.84711 WP_000124693.1.84721 WP_000124693.1.84727 WP_000124693.1.84744 WP_000124693.1.84745 WP_000124693.1.84773 WP_000124693.1.84814 WP_000124693.1.84872 WP_000124693.1.84876 WP_000124693.1.84879 WP_000124693.1.84899 WP_000124693.1.849 WP_000124693.1.84945 WP_000124693.1.84967 WP_000124693.1.8497 WP_000124693.1.84983 WP_000124693.1.850 WP_000124693.1.85004 WP_000124693.1.85014 WP_000124693.1.8502 WP_000124693.1.85031 WP_000124693.1.85039 WP_000124693.1.85040 WP_000124693.1.85079 WP_000124693.1.85094 WP_000124693.1.85120 WP_000124693.1.85126 WP_000124693.1.85134 WP_000124693.1.85147 WP_000124693.1.85153 WP_000124693.1.85178 WP_000124693.1.85180 WP_000124693.1.85190 WP_000124693.1.85192 WP_000124693.1.85217 WP_000124693.1.8526 WP_000124693.1.85271 WP_000124693.1.85273 WP_000124693.1.85301 WP_000124693.1.8533 WP_000124693.1.85338 WP_000124693.1.85339 WP_000124693.1.8537 WP_000124693.1.85408 WP_000124693.1.85433 WP_000124693.1.8545 WP_000124693.1.85456 WP_000124693.1.85469 WP_000124693.1.85481 WP_000124693.1.85483 WP_000124693.1.85511 WP_000124693.1.85512 WP_000124693.1.8552 WP_000124693.1.85541 WP_000124693.1.8556 WP_000124693.1.85568 WP_000124693.1.8557 WP_000124693.1.85606 WP_000124693.1.85615 WP_000124693.1.85617 WP_000124693.1.85635 WP_000124693.1.85646 WP_000124693.1.85654 WP_000124693.1.85663 WP_000124693.1.85665 WP_000124693.1.85669 WP_000124693.1.85671 WP_000124693.1.85672 WP_000124693.1.85675 WP_000124693.1.85688 WP_000124693.1.85703 WP_000124693.1.85723 WP_000124693.1.85728 WP_000124693.1.85742 WP_000124693.1.85746 WP_000124693.1.85759 WP_000124693.1.85777 WP_000124693.1.85780 WP_000124693.1.85784 WP_000124693.1.85797 WP_000124693.1.85811 WP_000124693.1.85854 WP_000124693.1.85855 WP_000124693.1.85864 WP_000124693.1.85886 WP_000124693.1.859 WP_000124693.1.85900 WP_000124693.1.85904 WP_000124693.1.8591 WP_000124693.1.85917 WP_000124693.1.8594 WP_000124693.1.85943 WP_000124693.1.85976 WP_000124693.1.85977 WP_000124693.1.85982 WP_000124693.1.860 WP_000124693.1.86007 WP_000124693.1.86010 WP_000124693.1.86017 WP_000124693.1.86043 WP_000124693.1.8605 WP_000124693.1.86084 WP_000124693.1.86092 WP_000124693.1.8610 WP_000124693.1.86120 WP_000124693.1.86126 WP_000124693.1.86138 WP_000124693.1.8614 WP_000124693.1.86156 WP_000124693.1.86157 WP_000124693.1.86159 WP_000124693.1.8616 WP_000124693.1.86173 WP_000124693.1.86206 WP_000124693.1.86224 WP_000124693.1.86240 WP_000124693.1.86259 WP_000124693.1.86284 WP_000124693.1.86285 WP_000124693.1.86306 WP_000124693.1.86310 WP_000124693.1.86316 WP_000124693.1.86323 WP_000124693.1.86335 WP_000124693.1.86342 WP_000124693.1.86347 WP_000124693.1.86356 WP_000124693.1.86380 WP_000124693.1.86389 WP_000124693.1.8640 WP_000124693.1.8642 WP_000124693.1.86426 WP_000124693.1.86442 WP_000124693.1.86450 WP_000124693.1.86453 WP_000124693.1.86466 WP_000124693.1.86469 WP_000124693.1.8647 WP_000124693.1.86489 WP_000124693.1.86514 WP_000124693.1.86530 WP_000124693.1.86580 WP_000124693.1.86588 WP_000124693.1.86593 WP_000124693.1.86601 WP_000124693.1.86610 WP_000124693.1.86634 WP_000124693.1.86656 WP_000124693.1.86658 WP_000124693.1.86661 WP_000124693.1.86663 WP_000124693.1.86676 WP_000124693.1.86699 WP_000124693.1.8671 WP_000124693.1.8672 WP_000124693.1.86735 WP_000124693.1.86744 WP_000124693.1.86770 WP_000124693.1.8678 WP_000124693.1.86794 WP_000124693.1.86800 WP_000124693.1.86807 WP_000124693.1.86810 WP_000124693.1.86811 WP_000124693.1.86815 WP_000124693.1.8684 WP_000124693.1.86859 WP_000124693.1.86860 WP_000124693.1.86895 WP_000124693.1.86902 WP_000124693.1.86906 WP_000124693.1.8691 WP_000124693.1.86915 WP_000124693.1.86921 WP_000124693.1.86945 WP_000124693.1.86982 WP_000124693.1.86989 WP_000124693.1.87023 WP_000124693.1.87034 WP_000124693.1.87038 WP_000124693.1.87041 WP_000124693.1.87051 WP_000124693.1.87095 WP_000124693.1.87136 WP_000124693.1.87143 WP_000124693.1.87148 WP_000124693.1.87155 WP_000124693.1.87187 WP_000124693.1.87219 WP_000124693.1.8722 WP_000124693.1.87220 WP_000124693.1.87258 WP_000124693.1.87265 WP_000124693.1.87276 WP_000124693.1.87282 WP_000124693.1.87283 WP_000124693.1.87293 WP_000124693.1.87323 WP_000124693.1.87346 WP_000124693.1.8736 WP_000124693.1.87365 WP_000124693.1.87370 WP_000124693.1.87376 WP_000124693.1.87420 WP_000124693.1.87460 WP_000124693.1.87484 WP_000124693.1.87493 WP_000124693.1.87500 WP_000124693.1.87528 WP_000124693.1.87552 WP_000124693.1.87560 WP_000124693.1.87583 WP_000124693.1.87584 WP_000124693.1.8760 WP_000124693.1.87600 WP_000124693.1.87609 WP_000124693.1.87612 WP_000124693.1.87615 WP_000124693.1.87618 WP_000124693.1.87626 WP_000124693.1.87651 WP_000124693.1.87653 WP_000124693.1.87659 WP_000124693.1.8767 WP_000124693.1.87687 WP_000124693.1.87695 WP_000124693.1.87698 WP_000124693.1.87706 WP_000124693.1.87712 WP_000124693.1.87739 WP_000124693.1.87741 WP_000124693.1.87742 WP_000124693.1.87760 WP_000124693.1.87779 WP_000124693.1.87813 WP_000124693.1.87852 WP_000124693.1.87875 WP_000124693.1.87891 WP_000124693.1.87899 WP_000124693.1.87905 WP_000124693.1.8792 WP_000124693.1.87936 WP_000124693.1.87945 WP_000124693.1.87949 WP_000124693.1.87999 WP_000124693.1.8800 WP_000124693.1.88014 WP_000124693.1.88019 WP_000124693.1.88025 WP_000124693.1.88026 WP_000124693.1.8805 WP_000124693.1.88052 WP_000124693.1.8806 WP_000124693.1.88073 WP_000124693.1.8809 WP_000124693.1.88092 WP_000124693.1.881 WP_000124693.1.88136 WP_000124693.1.88145 WP_000124693.1.88165 WP_000124693.1.88174 WP_000124693.1.88185 WP_000124693.1.88199 WP_000124693.1.88214 WP_000124693.1.88222 WP_000124693.1.88244 WP_000124693.1.88264 WP_000124693.1.88275 WP_000124693.1.88291 WP_000124693.1.88293 WP_000124693.1.88299 WP_000124693.1.88303 WP_000124693.1.88313 WP_000124693.1.88356 WP_000124693.1.88359 WP_000124693.1.8837 WP_000124693.1.88393 WP_000124693.1.88414 WP_000124693.1.88423 WP_000124693.1.88444 WP_000124693.1.88446 WP_000124693.1.88458 WP_000124693.1.88474 WP_000124693.1.88483 WP_000124693.1.8849 WP_000124693.1.88501 WP_000124693.1.88508 WP_000124693.1.88538 WP_000124693.1.88547 WP_000124693.1.88597 WP_000124693.1.886 WP_000124693.1.88609 WP_000124693.1.88620 WP_000124693.1.88624 WP_000124693.1.88647 WP_000124693.1.88648 WP_000124693.1.88651 WP_000124693.1.88675 WP_000124693.1.88683 WP_000124693.1.88692 WP_000124693.1.88698 WP_000124693.1.88703 WP_000124693.1.88707 WP_000124693.1.88727 WP_000124693.1.88731 WP_000124693.1.88762 WP_000124693.1.88772 WP_000124693.1.88776 WP_000124693.1.88792 WP_000124693.1.88817 WP_000124693.1.88845 WP_000124693.1.88850 WP_000124693.1.88854 WP_000124693.1.8889 WP_000124693.1.88892 WP_000124693.1.88894 WP_000124693.1.88902 WP_000124693.1.8891 WP_000124693.1.88942 WP_000124693.1.88957 WP_000124693.1.88966 WP_000124693.1.88967 WP_000124693.1.88968 WP_000124693.1.88970 WP_000124693.1.88980 WP_000124693.1.88981 WP_000124693.1.88982 WP_000124693.1.88995 WP_000124693.1.88998 WP_000124693.1.89008 WP_000124693.1.89054 WP_000124693.1.89114 WP_000124693.1.89116 WP_000124693.1.89119 WP_000124693.1.89120 WP_000124693.1.89138 WP_000124693.1.89174 WP_000124693.1.89177 WP_000124693.1.89182 WP_000124693.1.89188 WP_000124693.1.89215 WP_000124693.1.89221 WP_000124693.1.89291 WP_000124693.1.89298 WP_000124693.1.89304 WP_000124693.1.89308 WP_000124693.1.89311 WP_000124693.1.89314 WP_000124693.1.89328 WP_000124693.1.89332 WP_000124693.1.89343 WP_000124693.1.89354 WP_000124693.1.89355 WP_000124693.1.89362 WP_000124693.1.89395 WP_000124693.1.8940 WP_000124693.1.89408 WP_000124693.1.89425 WP_000124693.1.89449 WP_000124693.1.89452 WP_000124693.1.89462 WP_000124693.1.8947 WP_000124693.1.89503 WP_000124693.1.89512 WP_000124693.1.89527 WP_000124693.1.89570 WP_000124693.1.8958 WP_000124693.1.89580 WP_000124693.1.89591 WP_000124693.1.89604 WP_000124693.1.89606 WP_000124693.1.8961 WP_000124693.1.89612 WP_000124693.1.89622 WP_000124693.1.89632 WP_000124693.1.89634 WP_000124693.1.89647 WP_000124693.1.89657 WP_000124693.1.89659 WP_000124693.1.89668 WP_000124693.1.89680 WP_000124693.1.89706 WP_000124693.1.89713 WP_000124693.1.89733 WP_000124693.1.89746 WP_000124693.1.89764 WP_000124693.1.89765 WP_000124693.1.89777 WP_000124693.1.89789 WP_000124693.1.89796 WP_000124693.1.89804 WP_000124693.1.89815 WP_000124693.1.89817 WP_000124693.1.89832 WP_000124693.1.89845 WP_000124693.1.89870 WP_000124693.1.89888 WP_000124693.1.89902 WP_000124693.1.89911 WP_000124693.1.89914 WP_000124693.1.89940 WP_000124693.1.8995 WP_000124693.1.89952 WP_000124693.1.8996 WP_000124693.1.89965 WP_000124693.1.89975 WP_000124693.1.90007 WP_000124693.1.9002 WP_000124693.1.9003 WP_000124693.1.90033 WP_000124693.1.90084 WP_000124693.1.90097 WP_000124693.1.90108 WP_000124693.1.9011 WP_000124693.1.90193 WP_000124693.1.90196 WP_000124693.1.90211 WP_000124693.1.90220 WP_000124693.1.90240 WP_000124693.1.90248 WP_000124693.1.90252 WP_000124693.1.90274 WP_000124693.1.90280 WP_000124693.1.90293 WP_000124693.1.90302 WP_000124693.1.90311 WP_000124693.1.90330 WP_000124693.1.90338 WP_000124693.1.90348 WP_000124693.1.90363 WP_000124693.1.90365 WP_000124693.1.90409 WP_000124693.1.90417 WP_000124693.1.90421 WP_000124693.1.90428 WP_000124693.1.90440 WP_000124693.1.90453 WP_000124693.1.90458 WP_000124693.1.90472 WP_000124693.1.90489 WP_000124693.1.90513 WP_000124693.1.90521 WP_000124693.1.90522 WP_000124693.1.90540 WP_000124693.1.90557 WP_000124693.1.90563 WP_000124693.1.90566 WP_000124693.1.90582 WP_000124693.1.90585 WP_000124693.1.90620 WP_000124693.1.9064 WP_000124693.1.90641 WP_000124693.1.90686 WP_000124693.1.90701 WP_000124693.1.90713 WP_000124693.1.90734 WP_000124693.1.90748 WP_000124693.1.90752 WP_000124693.1.90759 WP_000124693.1.90792 WP_000124693.1.90794 WP_000124693.1.90796 WP_000124693.1.90811 WP_000124693.1.90814 WP_000124693.1.90859 WP_000124693.1.90866 WP_000124693.1.90876 WP_000124693.1.90878 WP_000124693.1.9089 WP_000124693.1.9091 WP_000124693.1.9093 WP_000124693.1.90959 WP_000124693.1.90973 WP_000124693.1.90983 WP_000124693.1.90984 WP_000124693.1.90991 WP_000124693.1.91003 WP_000124693.1.91023 WP_000124693.1.91042 WP_000124693.1.91049 WP_000124693.1.91056 WP_000124693.1.91067 WP_000124693.1.91069 WP_000124693.1.91107 WP_000124693.1.91156 WP_000124693.1.91164 WP_000124693.1.91179 WP_000124693.1.91189 WP_000124693.1.91205 WP_000124693.1.91215 WP_000124693.1.91239 WP_000124693.1.91278 WP_000124693.1.91282 WP_000124693.1.91291 WP_000124693.1.9131 WP_000124693.1.91312 WP_000124693.1.91313 WP_000124693.1.91331 WP_000124693.1.91334 WP_000124693.1.9135 WP_000124693.1.9137 WP_000124693.1.91372 WP_000124693.1.91381 WP_000124693.1.91405 WP_000124693.1.91424 WP_000124693.1.91453 WP_000124693.1.91459 WP_000124693.1.91470 WP_000124693.1.91473 WP_000124693.1.91474 WP_000124693.1.91493 WP_000124693.1.91505 WP_000124693.1.91506 WP_000124693.1.91512 WP_000124693.1.91524 WP_000124693.1.91528 WP_000124693.1.91557 WP_000124693.1.91564 WP_000124693.1.91579 WP_000124693.1.91580 WP_000124693.1.91597 WP_000124693.1.91621 WP_000124693.1.91625 WP_000124693.1.91628 WP_000124693.1.91655 WP_000124693.1.9166 WP_000124693.1.91702 WP_000124693.1.91715 WP_000124693.1.91724 WP_000124693.1.91736 WP_000124693.1.91742 WP_000124693.1.91772 WP_000124693.1.91776 WP_000124693.1.91788 WP_000124693.1.91795 WP_000124693.1.91806 WP_000124693.1.91864 WP_000124693.1.9187 WP_000124693.1.91870 WP_000124693.1.91880 WP_000124693.1.91898 WP_000124693.1.91903 WP_000124693.1.91904 WP_000124693.1.91914 WP_000124693.1.91974 WP_000124693.1.91984 WP_000124693.1.92013 WP_000124693.1.92018 WP_000124693.1.92039 WP_000124693.1.92044 WP_000124693.1.92047 WP_000124693.1.92060 WP_000124693.1.92067 WP_000124693.1.92068 WP_000124693.1.92082 WP_000124693.1.92087 WP_000124693.1.92093 WP_000124693.1.92098 WP_000124693.1.92099 WP_000124693.1.92108 WP_000124693.1.92122 WP_000124693.1.92129 WP_000124693.1.92149 WP_000124693.1.92156 WP_000124693.1.92165 WP_000124693.1.92171 WP_000124693.1.92172 WP_000124693.1.92183 WP_000124693.1.92208 WP_000124693.1.92213 WP_000124693.1.9222 WP_000124693.1.92240 WP_000124693.1.92243 WP_000124693.1.92268 WP_000124693.1.92270 WP_000124693.1.92299 WP_000124693.1.92310 WP_000124693.1.92318 WP_000124693.1.92327 WP_000124693.1.92375 WP_000124693.1.92394 WP_000124693.1.92399 WP_000124693.1.92408 WP_000124693.1.92411 WP_000124693.1.92439 WP_000124693.1.92443 WP_000124693.1.92452 WP_000124693.1.92470 WP_000124693.1.92477 WP_000124693.1.92482 WP_000124693.1.92529 WP_000124693.1.9253 WP_000124693.1.92531 WP_000124693.1.92545 WP_000124693.1.92557 WP_000124693.1.92562 WP_000124693.1.92570 WP_000124693.1.92575 WP_000124693.1.92588 WP_000124693.1.926 WP_000124693.1.92628 WP_000124693.1.92633 WP_000124693.1.92646 WP_000124693.1.92649 WP_000124693.1.92659 WP_000124693.1.92669 WP_000124693.1.92671 WP_000124693.1.92676 WP_000124693.1.92705 WP_000124693.1.9271 WP_000124693.1.92729 WP_000124693.1.92734 WP_000124693.1.92738 WP_000124693.1.92754 WP_000124693.1.92758 WP_000124693.1.9276 WP_000124693.1.92786 WP_000124693.1.92806 WP_000124693.1.92810 WP_000124693.1.92823 WP_000124693.1.92827 WP_000124693.1.92832 WP_000124693.1.92836 WP_000124693.1.92842 WP_000124693.1.92843 WP_000124693.1.92875 WP_000124693.1.92879 WP_000124693.1.92883 WP_000124693.1.92890 WP_000124693.1.92893 WP_000124693.1.92895 WP_000124693.1.92926 WP_000124693.1.92929 WP_000124693.1.92936 WP_000124693.1.92939 WP_000124693.1.92947 WP_000124693.1.92975 WP_000124693.1.92987 WP_000124693.1.92988 WP_000124693.1.93007 WP_000124693.1.93022 WP_000124693.1.93059 WP_000124693.1.93061 WP_000124693.1.93076 WP_000124693.1.93086 WP_000124693.1.93101 WP_000124693.1.93103 WP_000124693.1.93105 WP_000124693.1.93111 WP_000124693.1.93118 WP_000124693.1.93121 WP_000124693.1.93136 WP_000124693.1.93155 WP_000124693.1.93168 WP_000124693.1.93184 WP_000124693.1.93213 WP_000124693.1.93215 WP_000124693.1.93221 WP_000124693.1.93223 WP_000124693.1.93239 WP_000124693.1.93275 WP_000124693.1.93302 WP_000124693.1.93322 WP_000124693.1.93339 WP_000124693.1.93350 WP_000124693.1.9336 WP_000124693.1.93365 WP_000124693.1.93376 WP_000124693.1.93387 WP_000124693.1.93410 WP_000124693.1.93469 WP_000124693.1.93511 WP_000124693.1.93512 WP_000124693.1.93524 WP_000124693.1.93543 WP_000124693.1.93577 WP_000124693.1.93596 WP_000124693.1.93604 WP_000124693.1.93635 WP_000124693.1.93648 WP_000124693.1.93650 WP_000124693.1.93656 WP_000124693.1.93657 WP_000124693.1.93662 WP_000124693.1.93671 WP_000124693.1.93691 WP_000124693.1.937 WP_000124693.1.93705 WP_000124693.1.9374 WP_000124693.1.93741 WP_000124693.1.9375 WP_000124693.1.93754 WP_000124693.1.93761 WP_000124693.1.93767 WP_000124693.1.93780 WP_000124693.1.9380 WP_000124693.1.93803 WP_000124693.1.93804 WP_000124693.1.93809 WP_000124693.1.93828 WP_000124693.1.93837 WP_000124693.1.93842 WP_000124693.1.93843 WP_000124693.1.93875 WP_000124693.1.9389 WP_000124693.1.93909 WP_000124693.1.93919 WP_000124693.1.93937 WP_000124693.1.93938 WP_000124693.1.93956 WP_000124693.1.93984 WP_000124693.1.93986 WP_000124693.1.9399 WP_000124693.1.93994 WP_000124693.1.94017 WP_000124693.1.94039 WP_000124693.1.94056 WP_000124693.1.94064 WP_000124693.1.94070 WP_000124693.1.94071 WP_000124693.1.94072 WP_000124693.1.94079 WP_000124693.1.94097 WP_000124693.1.94107 WP_000124693.1.94132 WP_000124693.1.94142 WP_000124693.1.94162 WP_000124693.1.94167 WP_000124693.1.94168 WP_000124693.1.94181 WP_000124693.1.94198 WP_000124693.1.94215 WP_000124693.1.94303 WP_000124693.1.9432 WP_000124693.1.94352 WP_000124693.1.94354 WP_000124693.1.94365 WP_000124693.1.94379 WP_000124693.1.94380 WP_000124693.1.94383 WP_000124693.1.94390 WP_000124693.1.9440 WP_000124693.1.94412 WP_000124693.1.94415 WP_000124693.1.94458 WP_000124693.1.94461 WP_000124693.1.94473 WP_000124693.1.94492 WP_000124693.1.94510 WP_000124693.1.94527 WP_000124693.1.94557 WP_000124693.1.94562 WP_000124693.1.94565 WP_000124693.1.94573 WP_000124693.1.94579 WP_000124693.1.94584 WP_000124693.1.94586 WP_000124693.1.94588 WP_000124693.1.94593 WP_000124693.1.94598 WP_000124693.1.94622 WP_000124693.1.9463 WP_000124693.1.94649 WP_000124693.1.94650 WP_000124693.1.94655 WP_000124693.1.94659 WP_000124693.1.94662 WP_000124693.1.94669 WP_000124693.1.94670 WP_000124693.1.94674 WP_000124693.1.94700 WP_000124693.1.94717 WP_000124693.1.94722 WP_000124693.1.94745 WP_000124693.1.94782 WP_000124693.1.94796 WP_000124693.1.9481 WP_000124693.1.94815 WP_000124693.1.94817 WP_000124693.1.94820 WP_000124693.1.94835 WP_000124693.1.94849 WP_000124693.1.94850 WP_000124693.1.94851 WP_000124693.1.94862 WP_000124693.1.94864 WP_000124693.1.94947 WP_000124693.1.94952 WP_000124693.1.94959 WP_000124693.1.94967 WP_000124693.1.94971 WP_000124693.1.94982 WP_000124693.1.94983 WP_000124693.1.94986 WP_000124693.1.94987 WP_000124693.1.95006 WP_000124693.1.9503 WP_000124693.1.95051 WP_000124693.1.95055 WP_000124693.1.95076 WP_000124693.1.95085 WP_000124693.1.95094 WP_000124693.1.95099 WP_000124693.1.95121 WP_000124693.1.95133 WP_000124693.1.95136 WP_000124693.1.95152 WP_000124693.1.9516 WP_000124693.1.95165 WP_000124693.1.95171 WP_000124693.1.95235 WP_000124693.1.95239 WP_000124693.1.95246 WP_000124693.1.95248 WP_000124693.1.95249 WP_000124693.1.9525 WP_000124693.1.95255 WP_000124693.1.95265 WP_000124693.1.9527 WP_000124693.1.95277 WP_000124693.1.95282 WP_000124693.1.95289 WP_000124693.1.95298 WP_000124693.1.9530 WP_000124693.1.95320 WP_000124693.1.95338 WP_000124693.1.95388 WP_000124693.1.95404 WP_000124693.1.95412 WP_000124693.1.95434 WP_000124693.1.95447 WP_000124693.1.95456 WP_000124693.1.95465 WP_000124693.1.95530 WP_000124693.1.95546 WP_000124693.1.95547 WP_000124693.1.95558 WP_000124693.1.95579 WP_000124693.1.95590 WP_000124693.1.95607 WP_000124693.1.95623 WP_000124693.1.95625 WP_000124693.1.95630 WP_000124693.1.95641 WP_000124693.1.95656 WP_000124693.1.95670 WP_000124693.1.95675 WP_000124693.1.95691 WP_000124693.1.95701 WP_000124693.1.95703 WP_000124693.1.95716 WP_000124693.1.95729 WP_000124693.1.9574 WP_000124693.1.95744 WP_000124693.1.95757 WP_000124693.1.95776 WP_000124693.1.95803 WP_000124693.1.95805 WP_000124693.1.95826 WP_000124693.1.95840 WP_000124693.1.9586 WP_000124693.1.95866 WP_000124693.1.95884 WP_000124693.1.95890 WP_000124693.1.95901 WP_000124693.1.95906 WP_000124693.1.95911 WP_000124693.1.95939 WP_000124693.1.95940 WP_000124693.1.95963 WP_000124693.1.96004 WP_000124693.1.96025 WP_000124693.1.96042 WP_000124693.1.96044 WP_000124693.1.96045 WP_000124693.1.96054 WP_000124693.1.9609 WP_000124693.1.96094 WP_000124693.1.96107 WP_000124693.1.96127 WP_000124693.1.96139 WP_000124693.1.96141 WP_000124693.1.96144 WP_000124693.1.96162 WP_000124693.1.96172 WP_000124693.1.96188 WP_000124693.1.96190 WP_000124693.1.96206 WP_000124693.1.96211 WP_000124693.1.96212 WP_000124693.1.9624 WP_000124693.1.96260 WP_000124693.1.9627 WP_000124693.1.9628 WP_000124693.1.96317 WP_000124693.1.96319 WP_000124693.1.9633 WP_000124693.1.96340 WP_000124693.1.96343 WP_000124693.1.96348 WP_000124693.1.96349 WP_000124693.1.96359 WP_000124693.1.96380 WP_000124693.1.96404 WP_000124693.1.96429 WP_000124693.1.9644 WP_000124693.1.96469 WP_000124693.1.96490 WP_000124693.1.96497 WP_000124693.1.96500 WP_000124693.1.96521 WP_000124693.1.96533 WP_000124693.1.96537 WP_000124693.1.96539 WP_000124693.1.96552 WP_000124693.1.96555 WP_000124693.1.96563 WP_000124693.1.96584 WP_000124693.1.96588 WP_000124693.1.96590 WP_000124693.1.96600 WP_000124693.1.96610 WP_000124693.1.96625 WP_000124693.1.96635 WP_000124693.1.9664 WP_000124693.1.96640 WP_000124693.1.96642 WP_000124693.1.96662 WP_000124693.1.96675 WP_000124693.1.9670 WP_000124693.1.96721 WP_000124693.1.96731 WP_000124693.1.96732 WP_000124693.1.96735 WP_000124693.1.9674 WP_000124693.1.96750 WP_000124693.1.96758 WP_000124693.1.96761 WP_000124693.1.96771 WP_000124693.1.96792 WP_000124693.1.96798 WP_000124693.1.96801 WP_000124693.1.96803 WP_000124693.1.96810 WP_000124693.1.9686 WP_000124693.1.96876 WP_000124693.1.96890 WP_000124693.1.96902 WP_000124693.1.96917 WP_000124693.1.96925 WP_000124693.1.96938 WP_000124693.1.96946 WP_000124693.1.96957 WP_000124693.1.96978 WP_000124693.1.96993 WP_000124693.1.97005 WP_000124693.1.97015 WP_000124693.1.97026 WP_000124693.1.97028 WP_000124693.1.97043 WP_000124693.1.97047 WP_000124693.1.97079 WP_000124693.1.97089 WP_000124693.1.97103 WP_000124693.1.97109 WP_000124693.1.97143 WP_000124693.1.97145 WP_000124693.1.97154 WP_000124693.1.97184 WP_000124693.1.97190 WP_000124693.1.97224 WP_000124693.1.97260 WP_000124693.1.97287 WP_000124693.1.97291 WP_000124693.1.97297 WP_000124693.1.97318 WP_000124693.1.97322 WP_000124693.1.97328 WP_000124693.1.97337 WP_000124693.1.97368 WP_000124693.1.97369 WP_000124693.1.97386 WP_000124693.1.97413 WP_000124693.1.97422 WP_000124693.1.97441 WP_000124693.1.97477 WP_000124693.1.97480 WP_000124693.1.97487 WP_000124693.1.97496 WP_000124693.1.97497 WP_000124693.1.97505 WP_000124693.1.97534 WP_000124693.1.97547 WP_000124693.1.97594 WP_000124693.1.97597 WP_000124693.1.97599 WP_000124693.1.97606 WP_000124693.1.97613 WP_000124693.1.97615 WP_000124693.1.97620 WP_000124693.1.97626 WP_000124693.1.97628 WP_000124693.1.97631 WP_000124693.1.97640 WP_000124693.1.97646 WP_000124693.1.97648 WP_000124693.1.97656 WP_000124693.1.97690 WP_000124693.1.97691 WP_000124693.1.97693 WP_000124693.1.97704 WP_000124693.1.97725 WP_000124693.1.97726 WP_000124693.1.97727 WP_000124693.1.97732 WP_000124693.1.97736 WP_000124693.1.9774 WP_000124693.1.9775 WP_000124693.1.97768 WP_000124693.1.97772 WP_000124693.1.97800 WP_000124693.1.97819 WP_000124693.1.97840 WP_000124693.1.97846 WP_000124693.1.97873 WP_000124693.1.97907 WP_000124693.1.9793 WP_000124693.1.97938 WP_000124693.1.97981 WP_000124693.1.97983 WP_000124693.1.97986 WP_000124693.1.9799 WP_000124693.1.97991 WP_000124693.1.98006 WP_000124693.1.98019 WP_000124693.1.98022 WP_000124693.1.98036 WP_000124693.1.9805 WP_000124693.1.98080 WP_000124693.1.98086 WP_000124693.1.98107 WP_000124693.1.9811 WP_000124693.1.98110 WP_000124693.1.98119 WP_000124693.1.98124 WP_000124693.1.98146 WP_000124693.1.98158 WP_000124693.1.98170 WP_000124693.1.98201 WP_000124693.1.98219 WP_000124693.1.98236 WP_000124693.1.98250 WP_000124693.1.9826 WP_000124693.1.98263 WP_000124693.1.98266 WP_000124693.1.98314 WP_000124693.1.98338 WP_000124693.1.98392 WP_000124693.1.98402 WP_000124693.1.98403 WP_000124693.1.9841 WP_000124693.1.98418 WP_000124693.1.98438 WP_000124693.1.98440 WP_000124693.1.98446 WP_000124693.1.98448 WP_000124693.1.98457 WP_000124693.1.98472 WP_000124693.1.98483 WP_000124693.1.98495 WP_000124693.1.9850 WP_000124693.1.98502 WP_000124693.1.98513 WP_000124693.1.98531 WP_000124693.1.98551 WP_000124693.1.98558 WP_000124693.1.98570 WP_000124693.1.98577 WP_000124693.1.98607 WP_000124693.1.98608 WP_000124693.1.98627 WP_000124693.1.9863 WP_000124693.1.98634 WP_000124693.1.98676 WP_000124693.1.98677 WP_000124693.1.98726 WP_000124693.1.98731 WP_000124693.1.98751 WP_000124693.1.98760 WP_000124693.1.98762 WP_000124693.1.98763 WP_000124693.1.9877 WP_000124693.1.98779 WP_000124693.1.98801 WP_000124693.1.98818 WP_000124693.1.98843 WP_000124693.1.9887 WP_000124693.1.98899 WP_000124693.1.98931 WP_000124693.1.98947 WP_000124693.1.9898 WP_000124693.1.9899 WP_000124693.1.99040 WP_000124693.1.99057 WP_000124693.1.99071 WP_000124693.1.99072 WP_000124693.1.99073 WP_000124693.1.99083 WP_000124693.1.99097 WP_000124693.1.99098 WP_000124693.1.99107 WP_000124693.1.99163 WP_000124693.1.99164 WP_000124693.1.99184 WP_000124693.1.9919 WP_000124693.1.99197 WP_000124693.1.99198 WP_000124693.1.99215 WP_000124693.1.99219 WP_000124693.1.99255 WP_000124693.1.99267 WP_000124693.1.99276 WP_000124693.1.99278 WP_000124693.1.99327 WP_000124693.1.99335 WP_000124693.1.99339 WP_000124693.1.99350 WP_000124693.1.99360 WP_000124693.1.99363 WP_000124693.1.99369 WP_000124693.1.99370 WP_000124693.1.99388 WP_000124693.1.99397 WP_000124693.1.99426 WP_000124693.1.99456 WP_000124693.1.99463 WP_000124693.1.99469 WP_000124693.1.99483 WP_000124693.1.99490 WP_000124693.1.99493 WP_000124693.1.99531 WP_000124693.1.9954 WP_000124693.1.99546 WP_000124693.1.99561 WP_000124693.1.99577 WP_000124693.1.99579 WP_000124693.1.99595 WP_000124693.1.99613 WP_000124693.1.99626 WP_000124693.1.99630 WP_000124693.1.99637 WP_000124693.1.99646 WP_000124693.1.99657 WP_000124693.1.99660 WP_000124693.1.99671 WP_000124693.1.99676 WP_000124693.1.99712 WP_000124693.1.99725 WP_000124693.1.99747 WP_000124693.1.99764 WP_000124693.1.99783 WP_000124693.1.99813 WP_000124693.1.99824 WP_000124693.1.99829 WP_000124693.1.99837 WP_000124693.1.99841 WP_000124693.1.99858 WP_000124693.1.99889 WP_000124693.1.9992 WP_000124693.1.99924 WP_000124693.1.99958 WP_000124693.1.99961 WP_000124693.1.99996 gi|197364295|ref|YP_002143932.1| gi|16762837|ref|NP_458454.1| gi|550902792|ref|YP_008671884.1| 209261.t4059 220341.STY4352 272994.SPAB_04289 295319.SPA3312 321314.SC3380 423368.SNSL254_A3716 439843.SeSA_A3642 439851.SeD_A3814 454166.SeAg_B3643 454169.SeHA_C3751 476213.SPC_3515 550537.SEN3274 550538.SG3993 554290.SSPA3091 99287.STM3446 gi|525814717|ref|YP_008244735.1| gi|525945879|ref|YP_008306893.1| gi|207858688|ref|YP_002245339.1| gi|197247360|ref|YP_002148365.1| gi|526218608|ref|YP_008263806.1| gi|378452277|ref|YP_005239637.1| gi|386593121|ref|YP_006089521.1| gi|488656499|ref|YP_007928302.1| gi|525840415|ref|YP_008257938.1| gi|409247842|ref|YP_006888535.1| gi|62181950|ref|YP_218367.1| gi|16766735|ref|NP_462350.1| gi|528817159|ref|YP_008358362.1| gi|378962241|ref|YP_005219727.1| gi|194449555|ref|YP_002047469.1| gi|537439273|ref|YP_008483650.1| gi|538364043|ref|YP_008507328.1| gi|198243645|ref|YP_002217408.1| gi|378957706|ref|YP_005215193.1| gi|224585241|ref|YP_002639040.1| gi|378701340|ref|YP_005183298.1| gi|378990751|ref|YP_005253915.1| gi|194444018|ref|YP_002042696.1| gi|379702706|ref|YP_005244434.1| gi|549726001|ref|YP_008646191.1| gi|56415365|ref|YP_152440.1| gi|563654787|ref|YP_008862873.1| gi|549480782|ref|YP_008615084.1| gi|525859145|ref|YP_008262693.1| gi|529221676|ref|YP_008383262.1| gi|29144324|ref|NP_807666.1| gi|378446823|ref|YP_005234455.1| gi|194734071|ref|YP_002116388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]