SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161617870|ref|YP_001591835.1| from Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161617870|ref|YP_001591835.1|
Domain Number 1 Region: 10-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.34e-84
Family G proteins 0.0000953
Further Details:      
 
Domain Number 2 Region: 262-393
Classification Level Classification E-value
Superfamily Translation proteins 5.65e-28
Family Elongation factors 0.0091
Further Details:      
 
Domain Number 3 Region: 393-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.58e-17
Family EF-G/eEF-2 domains III and V 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161617870|ref|YP_001591835.1|
Sequence length 529
Comment peptide chain release factor 3 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
Sequence
MTLSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGTVKGRGSSQHAKSDWM
EMEKQRGISITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVE
DRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFK
GVYHLYKDETYLYQTGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVQGASNE
FDEELFLAGEITPVFFGTALGNFGVDHMLDGLVAWAPAPMPRQTDTRTVEASEEKFTGFV
FKIQANMDPKHRDRVAFMRVVSGKYEKGMKLRQVRTGKDVVISDALTFMAGDRSHVEEAY
PGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRIRLKDPLKQKQLLKGLVQLS
EEGAVQVFRPISNNDLIVGAVGVLQFDVVVARLKSEYNVEAIYESVNVATARWVESADAK
KFEEFKRKNETQLALDGGDNLTYIAPTMVNLNLTQERYPDVQFRKTREH
Download sequence
Identical sequences A0A0D6HN52 A0A0F6BBA3 A0A0F7JG88 A0A0H3NWG0 A0A0L3JJV9 A0A0M0PMG8 A0A0R9NH20 A0A0U0WMP3 A0A0U1F4A1 A0A1C2ZVL0 A0A1R2HQQ4 A0A1S0ZE12 A0A1X2RSS8 A0A1X2TES7 A0A1X2V8D7 A0A1X2YAA6 A0A1Z3QBL1 A0A221YTX1 A0A221Z4K6 A0A265BCP4 A0A267SH89 A0A271CJH1 A0A271D3G8 A0A2C6G9F4 A0A2D1XI42 A0A2D1XWC8 A0A2G1NJ55 A0A2H9YJN5 A0A2I6MCV8 A0A2I6MQL1 A0A2I6N4A7 A0A2I6NHR8 A0A2I6NVL8 A0A2I6P8G0 A0A2K0JAH1 A0A2K2Z462 A9N7C9 B4T4G3 B4TGZ2 B4TU33 B5BL11 B5F516 B5FTB7 B5R2J0 C0Q7L6 E8XCK3 G4CAG7 G5NM64 G5PWZ0 G5R9S2 M7RZ69 Q56121 Q57G48 Q5PK12 S4I1D3 S5HPZ3 V1HE64 V1X0U0 V7II19
gi|563655854|ref|YP_008863963.1| ABAK02000001|CDS_4100715-4102304 ABAM02000001|CDS_457752-459341 ABAN01000015|CDS_85421-83832 ABAO01000001|CDS_2746-4335 ABEH02000001|CDS_355525-357114 ABEI01000003|CDS_2986-4575 ABEJ01000001|CDS_139235-140824 ABEL01000014|CDS_89684-88095 ABEW01000003|CDS_332972-331383 ABFF01000017|CDS_2923-4512 ABFG01000006|CDS_199357-197768 AE006468|CDS_4813888-4815477 AE017220|CDS_4716197-4717786 AM933172|CDS_4646109-4647698 CP000026|CDS_4546457-4548046 CP000857|CDS_4793589-4795178 CP000886|CDS_4819463-4821052 CP001113|CDS_4784097-4785686 CP001120|CDS_4845234-4846823 CP001127|CDS_4670300-4671889 CP001138|CDS_4755118-4756707 CP001144|CDS_4803416-4805005 CP001363|CDS_4826721-4828310 FM200053|CDS_4543025-4544614 FN424405|CDS_4835866-4837455 NZ_ACBF01000003|CDS_233556-235145 gi|198243278|ref|YP_002218434.1| gi|378987225|ref|YP_005250381.1| gi|386589848|ref|YP_006086248.1| gi|194734334|ref|YP_002117474.1| gi|525839554|ref|YP_008256864.1| gi|62182978|ref|YP_219395.1| gi|526218932|ref|YP_008264221.1| gi|550903888|ref|YP_008672980.1| gi|549727065|ref|YP_008647255.1| gi|525815819|ref|YP_008245837.1| gi|207859686|ref|YP_002246337.1| gi|378447863|ref|YP_005235495.1| 272994.SPAB_05737 295319.SPA4374 321314.SC4408 423368.SNSL254_A4916 439843.SeSA_A4813 439851.SeD_A4974 454166.SeAg_B4881 454169.SeHA_C4968 476213.SPC_4696 550537.SEN4322 554290.SSPA4060 99287.STM4560 NP_463416.1.58477 WP_000175965.1.100007 WP_000175965.1.100010 WP_000175965.1.100017 WP_000175965.1.100077 WP_000175965.1.100115 WP_000175965.1.10013 WP_000175965.1.100137 WP_000175965.1.100149 WP_000175965.1.100165 WP_000175965.1.100191 WP_000175965.1.1002 WP_000175965.1.100234 WP_000175965.1.100258 WP_000175965.1.100288 WP_000175965.1.100376 WP_000175965.1.100392 WP_000175965.1.100412 WP_000175965.1.100413 WP_000175965.1.100424 WP_000175965.1.100432 WP_000175965.1.100436 WP_000175965.1.100438 WP_000175965.1.100457 WP_000175965.1.100484 WP_000175965.1.100488 WP_000175965.1.100502 WP_000175965.1.100519 WP_000175965.1.100521 WP_000175965.1.100557 WP_000175965.1.100584 WP_000175965.1.100597 WP_000175965.1.100605 WP_000175965.1.100642 WP_000175965.1.10065 WP_000175965.1.100650 WP_000175965.1.100707 WP_000175965.1.100711 WP_000175965.1.100714 WP_000175965.1.100721 WP_000175965.1.100730 WP_000175965.1.10074 WP_000175965.1.100750 WP_000175965.1.10076 WP_000175965.1.100773 WP_000175965.1.100776 WP_000175965.1.100781 WP_000175965.1.100790 WP_000175965.1.100793 WP_000175965.1.10081 WP_000175965.1.100814 WP_000175965.1.100857 WP_000175965.1.100869 WP_000175965.1.100870 WP_000175965.1.100871 WP_000175965.1.100882 WP_000175965.1.100886 WP_000175965.1.100895 WP_000175965.1.100932 WP_000175965.1.100944 WP_000175965.1.101007 WP_000175965.1.101020 WP_000175965.1.101042 WP_000175965.1.101074 WP_000175965.1.101078 WP_000175965.1.101088 WP_000175965.1.101091 WP_000175965.1.101094 WP_000175965.1.101111 WP_000175965.1.101112 WP_000175965.1.101123 WP_000175965.1.101147 WP_000175965.1.101180 WP_000175965.1.101199 WP_000175965.1.101223 WP_000175965.1.101239 WP_000175965.1.101259 WP_000175965.1.101284 WP_000175965.1.101291 WP_000175965.1.1013 WP_000175965.1.101320 WP_000175965.1.101353 WP_000175965.1.101386 WP_000175965.1.101404 WP_000175965.1.101420 WP_000175965.1.101425 WP_000175965.1.101454 WP_000175965.1.101473 WP_000175965.1.101519 WP_000175965.1.101541 WP_000175965.1.101543 WP_000175965.1.101589 WP_000175965.1.101609 WP_000175965.1.101612 WP_000175965.1.101634 WP_000175965.1.101636 WP_000175965.1.101639 WP_000175965.1.10164 WP_000175965.1.101666 WP_000175965.1.101674 WP_000175965.1.101707 WP_000175965.1.101724 WP_000175965.1.101734 WP_000175965.1.101741 WP_000175965.1.10177 WP_000175965.1.101776 WP_000175965.1.101815 WP_000175965.1.101832 WP_000175965.1.101839 WP_000175965.1.101841 WP_000175965.1.101868 WP_000175965.1.101878 WP_000175965.1.101904 WP_000175965.1.10191 WP_000175965.1.101917 WP_000175965.1.101927 WP_000175965.1.101949 WP_000175965.1.101953 WP_000175965.1.101975 WP_000175965.1.102009 WP_000175965.1.102111 WP_000175965.1.10220 WP_000175965.1.10231 WP_000175965.1.10237 WP_000175965.1.10266 WP_000175965.1.10293 WP_000175965.1.10300 WP_000175965.1.10310 WP_000175965.1.10429 WP_000175965.1.10439 WP_000175965.1.10463 WP_000175965.1.10465 WP_000175965.1.10498 WP_000175965.1.10507 WP_000175965.1.10521 WP_000175965.1.10566 WP_000175965.1.10568 WP_000175965.1.106 WP_000175965.1.10631 WP_000175965.1.10675 WP_000175965.1.10678 WP_000175965.1.10711 WP_000175965.1.10720 WP_000175965.1.10753 WP_000175965.1.10755 WP_000175965.1.10797 WP_000175965.1.10868 WP_000175965.1.10898 WP_000175965.1.10992 WP_000175965.1.11000 WP_000175965.1.11024 WP_000175965.1.11031 WP_000175965.1.11041 WP_000175965.1.11098 WP_000175965.1.1110 WP_000175965.1.11119 WP_000175965.1.11156 WP_000175965.1.11168 WP_000175965.1.11190 WP_000175965.1.11213 WP_000175965.1.11216 WP_000175965.1.11254 WP_000175965.1.11295 WP_000175965.1.113 WP_000175965.1.11304 WP_000175965.1.1135 WP_000175965.1.11362 WP_000175965.1.11369 WP_000175965.1.1137 WP_000175965.1.11386 WP_000175965.1.11405 WP_000175965.1.11444 WP_000175965.1.11455 WP_000175965.1.11458 WP_000175965.1.11479 WP_000175965.1.1150 WP_000175965.1.11511 WP_000175965.1.11518 WP_000175965.1.11526 WP_000175965.1.11528 WP_000175965.1.11532 WP_000175965.1.11544 WP_000175965.1.1156 WP_000175965.1.11565 WP_000175965.1.11588 WP_000175965.1.11603 WP_000175965.1.11621 WP_000175965.1.11677 WP_000175965.1.11681 WP_000175965.1.11687 WP_000175965.1.1169 WP_000175965.1.11735 WP_000175965.1.1174 WP_000175965.1.11763 WP_000175965.1.11772 WP_000175965.1.11810 WP_000175965.1.11824 WP_000175965.1.11834 WP_000175965.1.11841 WP_000175965.1.11868 WP_000175965.1.11875 WP_000175965.1.11897 WP_000175965.1.11900 WP_000175965.1.11936 WP_000175965.1.11938 WP_000175965.1.11964 WP_000175965.1.11978 WP_000175965.1.12017 WP_000175965.1.12025 WP_000175965.1.12027 WP_000175965.1.12047 WP_000175965.1.12059 WP_000175965.1.12063 WP_000175965.1.12106 WP_000175965.1.12114 WP_000175965.1.12144 WP_000175965.1.1215 WP_000175965.1.12159 WP_000175965.1.12160 WP_000175965.1.12168 WP_000175965.1.12210 WP_000175965.1.12244 WP_000175965.1.12280 WP_000175965.1.12282 WP_000175965.1.12308 WP_000175965.1.1232 WP_000175965.1.12340 WP_000175965.1.12351 WP_000175965.1.12370 WP_000175965.1.12374 WP_000175965.1.1239 WP_000175965.1.12396 WP_000175965.1.12397 WP_000175965.1.12456 WP_000175965.1.1246 WP_000175965.1.12472 WP_000175965.1.12484 WP_000175965.1.12485 WP_000175965.1.1250 WP_000175965.1.12546 WP_000175965.1.12568 WP_000175965.1.12569 WP_000175965.1.12584 WP_000175965.1.12585 WP_000175965.1.1264 WP_000175965.1.12650 WP_000175965.1.12696 WP_000175965.1.12701 WP_000175965.1.12728 WP_000175965.1.12865 WP_000175965.1.12877 WP_000175965.1.12879 WP_000175965.1.12936 WP_000175965.1.1299 WP_000175965.1.12995 WP_000175965.1.1300 WP_000175965.1.13027 WP_000175965.1.13076 WP_000175965.1.13101 WP_000175965.1.13102 WP_000175965.1.13106 WP_000175965.1.13130 WP_000175965.1.13207 WP_000175965.1.13247 WP_000175965.1.1326 WP_000175965.1.13262 WP_000175965.1.13274 WP_000175965.1.13334 WP_000175965.1.13367 WP_000175965.1.13391 WP_000175965.1.13414 WP_000175965.1.13429 WP_000175965.1.13446 WP_000175965.1.1346 WP_000175965.1.13488 WP_000175965.1.13509 WP_000175965.1.13528 WP_000175965.1.13573 WP_000175965.1.13602 WP_000175965.1.13625 WP_000175965.1.13661 WP_000175965.1.13669 WP_000175965.1.13677 WP_000175965.1.13691 WP_000175965.1.13741 WP_000175965.1.13750 WP_000175965.1.13764 WP_000175965.1.13799 WP_000175965.1.13812 WP_000175965.1.13819 WP_000175965.1.13827 WP_000175965.1.13829 WP_000175965.1.13857 WP_000175965.1.1387 WP_000175965.1.13908 WP_000175965.1.13932 WP_000175965.1.13967 WP_000175965.1.13968 WP_000175965.1.14001 WP_000175965.1.14011 WP_000175965.1.14050 WP_000175965.1.14056 WP_000175965.1.14111 WP_000175965.1.1412 WP_000175965.1.14151 WP_000175965.1.14212 WP_000175965.1.14239 WP_000175965.1.14286 WP_000175965.1.14296 WP_000175965.1.14320 WP_000175965.1.14369 WP_000175965.1.14379 WP_000175965.1.1440 WP_000175965.1.14406 WP_000175965.1.14410 WP_000175965.1.14436 WP_000175965.1.14446 WP_000175965.1.14458 WP_000175965.1.14466 WP_000175965.1.14495 WP_000175965.1.14505 WP_000175965.1.14516 WP_000175965.1.14524 WP_000175965.1.14528 WP_000175965.1.14554 WP_000175965.1.146 WP_000175965.1.14618 WP_000175965.1.14688 WP_000175965.1.14708 WP_000175965.1.14725 WP_000175965.1.14789 WP_000175965.1.14793 WP_000175965.1.14808 WP_000175965.1.14819 WP_000175965.1.14852 WP_000175965.1.14876 WP_000175965.1.1489 WP_000175965.1.14913 WP_000175965.1.14917 WP_000175965.1.14927 WP_000175965.1.14932 WP_000175965.1.14936 WP_000175965.1.14964 WP_000175965.1.15011 WP_000175965.1.15054 WP_000175965.1.15055 WP_000175965.1.15059 WP_000175965.1.15067 WP_000175965.1.15100 WP_000175965.1.15102 WP_000175965.1.15124 WP_000175965.1.15214 WP_000175965.1.15223 WP_000175965.1.15226 WP_000175965.1.15276 WP_000175965.1.15316 WP_000175965.1.15318 WP_000175965.1.15369 WP_000175965.1.1540 WP_000175965.1.15468 WP_000175965.1.15479 WP_000175965.1.15483 WP_000175965.1.15508 WP_000175965.1.15585 WP_000175965.1.15586 WP_000175965.1.15612 WP_000175965.1.15616 WP_000175965.1.15625 WP_000175965.1.15627 WP_000175965.1.15637 WP_000175965.1.15644 WP_000175965.1.15667 WP_000175965.1.1568 WP_000175965.1.15708 WP_000175965.1.15775 WP_000175965.1.15777 WP_000175965.1.15784 WP_000175965.1.15795 WP_000175965.1.158 WP_000175965.1.15830 WP_000175965.1.15835 WP_000175965.1.15862 WP_000175965.1.15881 WP_000175965.1.15910 WP_000175965.1.1592 WP_000175965.1.15938 WP_000175965.1.15978 WP_000175965.1.15986 WP_000175965.1.15995 WP_000175965.1.16000 WP_000175965.1.16004 WP_000175965.1.1601 WP_000175965.1.16028 WP_000175965.1.16032 WP_000175965.1.16047 WP_000175965.1.16062 WP_000175965.1.16063 WP_000175965.1.16103 WP_000175965.1.1611 WP_000175965.1.16125 WP_000175965.1.16158 WP_000175965.1.16166 WP_000175965.1.16172 WP_000175965.1.16201 WP_000175965.1.16226 WP_000175965.1.16233 WP_000175965.1.16244 WP_000175965.1.16284 WP_000175965.1.16328 WP_000175965.1.16331 WP_000175965.1.1635 WP_000175965.1.16361 WP_000175965.1.16363 WP_000175965.1.16365 WP_000175965.1.16366 WP_000175965.1.16394 WP_000175965.1.16453 WP_000175965.1.16468 WP_000175965.1.16474 WP_000175965.1.16508 WP_000175965.1.16525 WP_000175965.1.16551 WP_000175965.1.16563 WP_000175965.1.16565 WP_000175965.1.16581 WP_000175965.1.16614 WP_000175965.1.16650 WP_000175965.1.16656 WP_000175965.1.1668 WP_000175965.1.16686 WP_000175965.1.16691 WP_000175965.1.167 WP_000175965.1.16710 WP_000175965.1.16729 WP_000175965.1.16732 WP_000175965.1.16735 WP_000175965.1.16786 WP_000175965.1.16804 WP_000175965.1.16817 WP_000175965.1.16819 WP_000175965.1.16826 WP_000175965.1.16846 WP_000175965.1.16855 WP_000175965.1.16858 WP_000175965.1.16873 WP_000175965.1.1689 WP_000175965.1.16896 WP_000175965.1.16903 WP_000175965.1.16910 WP_000175965.1.16941 WP_000175965.1.16942 WP_000175965.1.16944 WP_000175965.1.16949 WP_000175965.1.16965 WP_000175965.1.16972 WP_000175965.1.1700 WP_000175965.1.17060 WP_000175965.1.17093 WP_000175965.1.17096 WP_000175965.1.17098 WP_000175965.1.17105 WP_000175965.1.17270 WP_000175965.1.17285 WP_000175965.1.17307 WP_000175965.1.1733 WP_000175965.1.1737 WP_000175965.1.17390 WP_000175965.1.174 WP_000175965.1.17439 WP_000175965.1.17447 WP_000175965.1.17480 WP_000175965.1.17482 WP_000175965.1.1749 WP_000175965.1.17504 WP_000175965.1.17525 WP_000175965.1.17546 WP_000175965.1.17560 WP_000175965.1.1757 WP_000175965.1.17583 WP_000175965.1.17629 WP_000175965.1.17693 WP_000175965.1.17702 WP_000175965.1.17703 WP_000175965.1.17705 WP_000175965.1.17732 WP_000175965.1.17743 WP_000175965.1.17747 WP_000175965.1.17755 WP_000175965.1.17758 WP_000175965.1.17865 WP_000175965.1.17886 WP_000175965.1.17891 WP_000175965.1.17901 WP_000175965.1.17914 WP_000175965.1.17919 WP_000175965.1.17936 WP_000175965.1.17949 WP_000175965.1.1798 WP_000175965.1.17991 WP_000175965.1.18019 WP_000175965.1.18056 WP_000175965.1.18061 WP_000175965.1.1807 WP_000175965.1.18092 WP_000175965.1.18103 WP_000175965.1.18109 WP_000175965.1.18111 WP_000175965.1.18122 WP_000175965.1.1814 WP_000175965.1.18149 WP_000175965.1.18163 WP_000175965.1.18177 WP_000175965.1.18178 WP_000175965.1.1818 WP_000175965.1.18192 WP_000175965.1.1825 WP_000175965.1.18254 WP_000175965.1.18265 WP_000175965.1.18267 WP_000175965.1.18277 WP_000175965.1.18281 WP_000175965.1.18282 WP_000175965.1.18355 WP_000175965.1.18365 WP_000175965.1.18384 WP_000175965.1.18426 WP_000175965.1.18445 WP_000175965.1.18468 WP_000175965.1.18483 WP_000175965.1.18485 WP_000175965.1.18489 WP_000175965.1.18607 WP_000175965.1.18641 WP_000175965.1.18686 WP_000175965.1.18692 WP_000175965.1.18705 WP_000175965.1.18715 WP_000175965.1.18737 WP_000175965.1.18776 WP_000175965.1.18822 WP_000175965.1.18847 WP_000175965.1.18881 WP_000175965.1.18886 WP_000175965.1.18895 WP_000175965.1.18919 WP_000175965.1.18940 WP_000175965.1.18949 WP_000175965.1.1895 WP_000175965.1.1897 WP_000175965.1.19030 WP_000175965.1.19038 WP_000175965.1.19053 WP_000175965.1.19055 WP_000175965.1.19064 WP_000175965.1.19093 WP_000175965.1.19163 WP_000175965.1.19174 WP_000175965.1.19240 WP_000175965.1.19273 WP_000175965.1.19291 WP_000175965.1.19320 WP_000175965.1.1935 WP_000175965.1.19357 WP_000175965.1.19373 WP_000175965.1.1939 WP_000175965.1.19405 WP_000175965.1.19433 WP_000175965.1.19458 WP_000175965.1.19460 WP_000175965.1.19461 WP_000175965.1.19469 WP_000175965.1.1954 WP_000175965.1.1955 WP_000175965.1.19588 WP_000175965.1.19614 WP_000175965.1.19616 WP_000175965.1.19642 WP_000175965.1.19656 WP_000175965.1.1968 WP_000175965.1.19683 WP_000175965.1.19702 WP_000175965.1.19706 WP_000175965.1.19723 WP_000175965.1.19724 WP_000175965.1.19740 WP_000175965.1.19749 WP_000175965.1.19784 WP_000175965.1.19793 WP_000175965.1.19802 WP_000175965.1.19809 WP_000175965.1.19823 WP_000175965.1.19834 WP_000175965.1.19851 WP_000175965.1.19863 WP_000175965.1.19867 WP_000175965.1.19884 WP_000175965.1.1990 WP_000175965.1.19967 WP_000175965.1.19970 WP_000175965.1.19975 WP_000175965.1.1998 WP_000175965.1.19987 WP_000175965.1.20 WP_000175965.1.20023 WP_000175965.1.20034 WP_000175965.1.20081 WP_000175965.1.20086 WP_000175965.1.20091 WP_000175965.1.2010 WP_000175965.1.20119 WP_000175965.1.20212 WP_000175965.1.2026 WP_000175965.1.20261 WP_000175965.1.20266 WP_000175965.1.20271 WP_000175965.1.20330 WP_000175965.1.20349 WP_000175965.1.2036 WP_000175965.1.20362 WP_000175965.1.20364 WP_000175965.1.20391 WP_000175965.1.2041 WP_000175965.1.20415 WP_000175965.1.20418 WP_000175965.1.20425 WP_000175965.1.20437 WP_000175965.1.20443 WP_000175965.1.20446 WP_000175965.1.20488 WP_000175965.1.20503 WP_000175965.1.20525 WP_000175965.1.2054 WP_000175965.1.20553 WP_000175965.1.20564 WP_000175965.1.20573 WP_000175965.1.20614 WP_000175965.1.20626 WP_000175965.1.20631 WP_000175965.1.20646 WP_000175965.1.20695 WP_000175965.1.20700 WP_000175965.1.20721 WP_000175965.1.20760 WP_000175965.1.20767 WP_000175965.1.20789 WP_000175965.1.20795 WP_000175965.1.20810 WP_000175965.1.20839 WP_000175965.1.20886 WP_000175965.1.20894 WP_000175965.1.20900 WP_000175965.1.20908 WP_000175965.1.2101 WP_000175965.1.21049 WP_000175965.1.2107 WP_000175965.1.21079 WP_000175965.1.21086 WP_000175965.1.21089 WP_000175965.1.21103 WP_000175965.1.21136 WP_000175965.1.21146 WP_000175965.1.2116 WP_000175965.1.21165 WP_000175965.1.21181 WP_000175965.1.21194 WP_000175965.1.21202 WP_000175965.1.21241 WP_000175965.1.21245 WP_000175965.1.21246 WP_000175965.1.21260 WP_000175965.1.21269 WP_000175965.1.21286 WP_000175965.1.2130 WP_000175965.1.21309 WP_000175965.1.21326 WP_000175965.1.21332 WP_000175965.1.21351 WP_000175965.1.21362 WP_000175965.1.2139 WP_000175965.1.21399 WP_000175965.1.21400 WP_000175965.1.21423 WP_000175965.1.21443 WP_000175965.1.2146 WP_000175965.1.21473 WP_000175965.1.21497 WP_000175965.1.21499 WP_000175965.1.21534 WP_000175965.1.21548 WP_000175965.1.21603 WP_000175965.1.21616 WP_000175965.1.21681 WP_000175965.1.21692 WP_000175965.1.21715 WP_000175965.1.21728 WP_000175965.1.21730 WP_000175965.1.21750 WP_000175965.1.21751 WP_000175965.1.21757 WP_000175965.1.21792 WP_000175965.1.21825 WP_000175965.1.21845 WP_000175965.1.21886 WP_000175965.1.21909 WP_000175965.1.21910 WP_000175965.1.21950 WP_000175965.1.21981 WP_000175965.1.21991 WP_000175965.1.22019 WP_000175965.1.22024 WP_000175965.1.2205 WP_000175965.1.22051 WP_000175965.1.22062 WP_000175965.1.22067 WP_000175965.1.22069 WP_000175965.1.22096 WP_000175965.1.22117 WP_000175965.1.22136 WP_000175965.1.22158 WP_000175965.1.22162 WP_000175965.1.22169 WP_000175965.1.22205 WP_000175965.1.2221 WP_000175965.1.22235 WP_000175965.1.2224 WP_000175965.1.22240 WP_000175965.1.22270 WP_000175965.1.22296 WP_000175965.1.22303 WP_000175965.1.22315 WP_000175965.1.22323 WP_000175965.1.22337 WP_000175965.1.22346 WP_000175965.1.2235 WP_000175965.1.22379 WP_000175965.1.22388 WP_000175965.1.22427 WP_000175965.1.22449 WP_000175965.1.22451 WP_000175965.1.22453 WP_000175965.1.22454 WP_000175965.1.2246 WP_000175965.1.22460 WP_000175965.1.22485 WP_000175965.1.22514 WP_000175965.1.22537 WP_000175965.1.22565 WP_000175965.1.22566 WP_000175965.1.22575 WP_000175965.1.22582 WP_000175965.1.22590 WP_000175965.1.22595 WP_000175965.1.22604 WP_000175965.1.22605 WP_000175965.1.22620 WP_000175965.1.22623 WP_000175965.1.22645 WP_000175965.1.22676 WP_000175965.1.22692 WP_000175965.1.22758 WP_000175965.1.22760 WP_000175965.1.2283 WP_000175965.1.22845 WP_000175965.1.22855 WP_000175965.1.22857 WP_000175965.1.22864 WP_000175965.1.22870 WP_000175965.1.22880 WP_000175965.1.22902 WP_000175965.1.22947 WP_000175965.1.22966 WP_000175965.1.22979 WP_000175965.1.23010 WP_000175965.1.23041 WP_000175965.1.23053 WP_000175965.1.23080 WP_000175965.1.23102 WP_000175965.1.23114 WP_000175965.1.2314 WP_000175965.1.23155 WP_000175965.1.23175 WP_000175965.1.23192 WP_000175965.1.23201 WP_000175965.1.2324 WP_000175965.1.23246 WP_000175965.1.23258 WP_000175965.1.23259 WP_000175965.1.23274 WP_000175965.1.23309 WP_000175965.1.23311 WP_000175965.1.23329 WP_000175965.1.23343 WP_000175965.1.23379 WP_000175965.1.23409 WP_000175965.1.2342 WP_000175965.1.23442 WP_000175965.1.23444 WP_000175965.1.23460 WP_000175965.1.23466 WP_000175965.1.23472 WP_000175965.1.23482 WP_000175965.1.23485 WP_000175965.1.235 WP_000175965.1.23500 WP_000175965.1.23503 WP_000175965.1.23509 WP_000175965.1.23513 WP_000175965.1.23529 WP_000175965.1.2358 WP_000175965.1.23587 WP_000175965.1.23621 WP_000175965.1.23629 WP_000175965.1.23631 WP_000175965.1.23634 WP_000175965.1.2364 WP_000175965.1.23643 WP_000175965.1.23646 WP_000175965.1.23670 WP_000175965.1.23675 WP_000175965.1.23685 WP_000175965.1.237 WP_000175965.1.23720 WP_000175965.1.23736 WP_000175965.1.23746 WP_000175965.1.23755 WP_000175965.1.2376 WP_000175965.1.2380 WP_000175965.1.23819 WP_000175965.1.23932 WP_000175965.1.23959 WP_000175965.1.24017 WP_000175965.1.24082 WP_000175965.1.24145 WP_000175965.1.24158 WP_000175965.1.24163 WP_000175965.1.24206 WP_000175965.1.24214 WP_000175965.1.24250 WP_000175965.1.24297 WP_000175965.1.24303 WP_000175965.1.24308 WP_000175965.1.24325 WP_000175965.1.24361 WP_000175965.1.24376 WP_000175965.1.24392 WP_000175965.1.24394 WP_000175965.1.24408 WP_000175965.1.24409 WP_000175965.1.24412 WP_000175965.1.24419 WP_000175965.1.24433 WP_000175965.1.24444 WP_000175965.1.24450 WP_000175965.1.24476 WP_000175965.1.24494 WP_000175965.1.24521 WP_000175965.1.24555 WP_000175965.1.24567 WP_000175965.1.24578 WP_000175965.1.2467 WP_000175965.1.24673 WP_000175965.1.24686 WP_000175965.1.24689 WP_000175965.1.24696 WP_000175965.1.24727 WP_000175965.1.24737 WP_000175965.1.24779 WP_000175965.1.24803 WP_000175965.1.24837 WP_000175965.1.24839 WP_000175965.1.24873 WP_000175965.1.24901 WP_000175965.1.24944 WP_000175965.1.24995 WP_000175965.1.25008 WP_000175965.1.25015 WP_000175965.1.25036 WP_000175965.1.25064 WP_000175965.1.25072 WP_000175965.1.25119 WP_000175965.1.25130 WP_000175965.1.25159 WP_000175965.1.25175 WP_000175965.1.25205 WP_000175965.1.25206 WP_000175965.1.25217 WP_000175965.1.25229 WP_000175965.1.2525 WP_000175965.1.25297 WP_000175965.1.25354 WP_000175965.1.25397 WP_000175965.1.25405 WP_000175965.1.25421 WP_000175965.1.25426 WP_000175965.1.25454 WP_000175965.1.25493 WP_000175965.1.25514 WP_000175965.1.25564 WP_000175965.1.25596 WP_000175965.1.25618 WP_000175965.1.25668 WP_000175965.1.2568 WP_000175965.1.25690 WP_000175965.1.2570 WP_000175965.1.25700 WP_000175965.1.25703 WP_000175965.1.25708 WP_000175965.1.25709 WP_000175965.1.25722 WP_000175965.1.25740 WP_000175965.1.25780 WP_000175965.1.2581 WP_000175965.1.25814 WP_000175965.1.25825 WP_000175965.1.25846 WP_000175965.1.25928 WP_000175965.1.25932 WP_000175965.1.25951 WP_000175965.1.25988 WP_000175965.1.26030 WP_000175965.1.26034 WP_000175965.1.26075 WP_000175965.1.26083 WP_000175965.1.26093 WP_000175965.1.26122 WP_000175965.1.26123 WP_000175965.1.26129 WP_000175965.1.26194 WP_000175965.1.26199 WP_000175965.1.26213 WP_000175965.1.26224 WP_000175965.1.26269 WP_000175965.1.26282 WP_000175965.1.26311 WP_000175965.1.26319 WP_000175965.1.2634 WP_000175965.1.26363 WP_000175965.1.26384 WP_000175965.1.26426 WP_000175965.1.26429 WP_000175965.1.26440 WP_000175965.1.26441 WP_000175965.1.26493 WP_000175965.1.26512 WP_000175965.1.26532 WP_000175965.1.26551 WP_000175965.1.26563 WP_000175965.1.26567 WP_000175965.1.26582 WP_000175965.1.26587 WP_000175965.1.2660 WP_000175965.1.26646 WP_000175965.1.2667 WP_000175965.1.26687 WP_000175965.1.26709 WP_000175965.1.2672 WP_000175965.1.26741 WP_000175965.1.26750 WP_000175965.1.26758 WP_000175965.1.26787 WP_000175965.1.26794 WP_000175965.1.26833 WP_000175965.1.26856 WP_000175965.1.26882 WP_000175965.1.26883 WP_000175965.1.26892 WP_000175965.1.26919 WP_000175965.1.26924 WP_000175965.1.26936 WP_000175965.1.26980 WP_000175965.1.27010 WP_000175965.1.27055 WP_000175965.1.27072 WP_000175965.1.27084 WP_000175965.1.27122 WP_000175965.1.27169 WP_000175965.1.27173 WP_000175965.1.272 WP_000175965.1.27206 WP_000175965.1.27223 WP_000175965.1.2723 WP_000175965.1.27255 WP_000175965.1.27272 WP_000175965.1.27279 WP_000175965.1.27314 WP_000175965.1.27342 WP_000175965.1.27383 WP_000175965.1.27419 WP_000175965.1.27423 WP_000175965.1.27452 WP_000175965.1.27513 WP_000175965.1.27522 WP_000175965.1.27523 WP_000175965.1.27535 WP_000175965.1.27544 WP_000175965.1.27547 WP_000175965.1.27556 WP_000175965.1.27616 WP_000175965.1.2763 WP_000175965.1.27632 WP_000175965.1.27638 WP_000175965.1.27655 WP_000175965.1.27658 WP_000175965.1.27665 WP_000175965.1.27679 WP_000175965.1.27707 WP_000175965.1.27713 WP_000175965.1.27755 WP_000175965.1.27761 WP_000175965.1.2777 WP_000175965.1.27776 WP_000175965.1.27800 WP_000175965.1.27815 WP_000175965.1.27833 WP_000175965.1.27857 WP_000175965.1.27883 WP_000175965.1.27892 WP_000175965.1.27969 WP_000175965.1.27977 WP_000175965.1.27995 WP_000175965.1.28002 WP_000175965.1.28032 WP_000175965.1.28037 WP_000175965.1.28056 WP_000175965.1.2806 WP_000175965.1.28073 WP_000175965.1.28094 WP_000175965.1.28116 WP_000175965.1.28126 WP_000175965.1.28139 WP_000175965.1.28170 WP_000175965.1.28174 WP_000175965.1.28200 WP_000175965.1.28225 WP_000175965.1.28232 WP_000175965.1.28233 WP_000175965.1.28235 WP_000175965.1.2825 WP_000175965.1.28301 WP_000175965.1.28302 WP_000175965.1.28303 WP_000175965.1.2835 WP_000175965.1.28370 WP_000175965.1.28393 WP_000175965.1.28462 WP_000175965.1.28512 WP_000175965.1.28514 WP_000175965.1.2853 WP_000175965.1.28538 WP_000175965.1.28570 WP_000175965.1.28575 WP_000175965.1.28612 WP_000175965.1.28620 WP_000175965.1.28625 WP_000175965.1.28655 WP_000175965.1.28673 WP_000175965.1.28694 WP_000175965.1.287 WP_000175965.1.28773 WP_000175965.1.28775 WP_000175965.1.2879 WP_000175965.1.28811 WP_000175965.1.28830 WP_000175965.1.2890 WP_000175965.1.28902 WP_000175965.1.28921 WP_000175965.1.28938 WP_000175965.1.28946 WP_000175965.1.28948 WP_000175965.1.28963 WP_000175965.1.28977 WP_000175965.1.29006 WP_000175965.1.29010 WP_000175965.1.29099 WP_000175965.1.2910 WP_000175965.1.29113 WP_000175965.1.29168 WP_000175965.1.29174 WP_000175965.1.29190 WP_000175965.1.29218 WP_000175965.1.2924 WP_000175965.1.29255 WP_000175965.1.29274 WP_000175965.1.2932 WP_000175965.1.29349 WP_000175965.1.29379 WP_000175965.1.29422 WP_000175965.1.29436 WP_000175965.1.29509 WP_000175965.1.29530 WP_000175965.1.29576 WP_000175965.1.29588 WP_000175965.1.29601 WP_000175965.1.29606 WP_000175965.1.29615 WP_000175965.1.29619 WP_000175965.1.29682 WP_000175965.1.29704 WP_000175965.1.29732 WP_000175965.1.29768 WP_000175965.1.29774 WP_000175965.1.29827 WP_000175965.1.2984 WP_000175965.1.29845 WP_000175965.1.29923 WP_000175965.1.29924 WP_000175965.1.29969 WP_000175965.1.29990 WP_000175965.1.30006 WP_000175965.1.30018 WP_000175965.1.30022 WP_000175965.1.30027 WP_000175965.1.3005 WP_000175965.1.30059 WP_000175965.1.30086 WP_000175965.1.30165 WP_000175965.1.3017 WP_000175965.1.30170 WP_000175965.1.30179 WP_000175965.1.30180 WP_000175965.1.30195 WP_000175965.1.30202 WP_000175965.1.30210 WP_000175965.1.30213 WP_000175965.1.30225 WP_000175965.1.30238 WP_000175965.1.30246 WP_000175965.1.30278 WP_000175965.1.30331 WP_000175965.1.30356 WP_000175965.1.30386 WP_000175965.1.30389 WP_000175965.1.30425 WP_000175965.1.30437 WP_000175965.1.30469 WP_000175965.1.30492 WP_000175965.1.30505 WP_000175965.1.30507 WP_000175965.1.30535 WP_000175965.1.30547 WP_000175965.1.30548 WP_000175965.1.30555 WP_000175965.1.30573 WP_000175965.1.30589 WP_000175965.1.30602 WP_000175965.1.30627 WP_000175965.1.30635 WP_000175965.1.3066 WP_000175965.1.3067 WP_000175965.1.3068 WP_000175965.1.30696 WP_000175965.1.30752 WP_000175965.1.3076 WP_000175965.1.30794 WP_000175965.1.3080 WP_000175965.1.30802 WP_000175965.1.30803 WP_000175965.1.30823 WP_000175965.1.30833 WP_000175965.1.30835 WP_000175965.1.3089 WP_000175965.1.30909 WP_000175965.1.30934 WP_000175965.1.3095 WP_000175965.1.30951 WP_000175965.1.30968 WP_000175965.1.30972 WP_000175965.1.31 WP_000175965.1.31011 WP_000175965.1.31042 WP_000175965.1.31086 WP_000175965.1.31092 WP_000175965.1.31107 WP_000175965.1.31122 WP_000175965.1.3113 WP_000175965.1.3114 WP_000175965.1.31155 WP_000175965.1.31167 WP_000175965.1.31171 WP_000175965.1.31185 WP_000175965.1.3119 WP_000175965.1.31190 WP_000175965.1.31195 WP_000175965.1.31196 WP_000175965.1.31198 WP_000175965.1.31210 WP_000175965.1.31214 WP_000175965.1.31219 WP_000175965.1.31222 WP_000175965.1.3124 WP_000175965.1.31240 WP_000175965.1.31251 WP_000175965.1.31262 WP_000175965.1.3127 WP_000175965.1.31272 WP_000175965.1.31281 WP_000175965.1.31335 WP_000175965.1.31362 WP_000175965.1.31435 WP_000175965.1.31451 WP_000175965.1.31476 WP_000175965.1.31504 WP_000175965.1.31515 WP_000175965.1.31546 WP_000175965.1.31578 WP_000175965.1.31585 WP_000175965.1.31658 WP_000175965.1.31665 WP_000175965.1.3167 WP_000175965.1.3170 WP_000175965.1.31720 WP_000175965.1.31725 WP_000175965.1.31762 WP_000175965.1.31782 WP_000175965.1.31845 WP_000175965.1.3185 WP_000175965.1.31854 WP_000175965.1.31895 WP_000175965.1.31901 WP_000175965.1.31927 WP_000175965.1.31940 WP_000175965.1.31952 WP_000175965.1.31967 WP_000175965.1.31972 WP_000175965.1.31983 WP_000175965.1.32038 WP_000175965.1.32054 WP_000175965.1.32056 WP_000175965.1.32109 WP_000175965.1.32116 WP_000175965.1.32170 WP_000175965.1.32192 WP_000175965.1.32204 WP_000175965.1.32206 WP_000175965.1.32252 WP_000175965.1.32260 WP_000175965.1.32274 WP_000175965.1.32275 WP_000175965.1.32277 WP_000175965.1.32309 WP_000175965.1.32357 WP_000175965.1.32368 WP_000175965.1.32408 WP_000175965.1.32423 WP_000175965.1.32424 WP_000175965.1.32438 WP_000175965.1.32459 WP_000175965.1.32491 WP_000175965.1.32493 WP_000175965.1.32515 WP_000175965.1.32519 WP_000175965.1.32527 WP_000175965.1.32545 WP_000175965.1.32629 WP_000175965.1.32643 WP_000175965.1.32660 WP_000175965.1.32668 WP_000175965.1.32702 WP_000175965.1.32714 WP_000175965.1.32740 WP_000175965.1.32747 WP_000175965.1.32750 WP_000175965.1.3278 WP_000175965.1.32786 WP_000175965.1.32804 WP_000175965.1.32832 WP_000175965.1.32860 WP_000175965.1.32881 WP_000175965.1.32899 WP_000175965.1.329 WP_000175965.1.32900 WP_000175965.1.32902 WP_000175965.1.32907 WP_000175965.1.32930 WP_000175965.1.32977 WP_000175965.1.33030 WP_000175965.1.3304 WP_000175965.1.33050 WP_000175965.1.33068 WP_000175965.1.33078 WP_000175965.1.3310 WP_000175965.1.33106 WP_000175965.1.33114 WP_000175965.1.33127 WP_000175965.1.33134 WP_000175965.1.33143 WP_000175965.1.33144 WP_000175965.1.33160 WP_000175965.1.33248 WP_000175965.1.33253 WP_000175965.1.33261 WP_000175965.1.33270 WP_000175965.1.333 WP_000175965.1.33392 WP_000175965.1.33409 WP_000175965.1.33420 WP_000175965.1.33492 WP_000175965.1.33499 WP_000175965.1.335 WP_000175965.1.33504 WP_000175965.1.33553 WP_000175965.1.3356 WP_000175965.1.33580 WP_000175965.1.33586 WP_000175965.1.33592 WP_000175965.1.33609 WP_000175965.1.33629 WP_000175965.1.3364 WP_000175965.1.33693 WP_000175965.1.33825 WP_000175965.1.33865 WP_000175965.1.33870 WP_000175965.1.33894 WP_000175965.1.3394 WP_000175965.1.3396 WP_000175965.1.33986 WP_000175965.1.34 WP_000175965.1.34022 WP_000175965.1.34043 WP_000175965.1.34075 WP_000175965.1.34084 WP_000175965.1.34091 WP_000175965.1.34107 WP_000175965.1.34126 WP_000175965.1.34179 WP_000175965.1.34184 WP_000175965.1.34185 WP_000175965.1.34257 WP_000175965.1.34259 WP_000175965.1.34279 WP_000175965.1.34292 WP_000175965.1.34319 WP_000175965.1.34330 WP_000175965.1.34364 WP_000175965.1.3438 WP_000175965.1.34417 WP_000175965.1.34424 WP_000175965.1.34431 WP_000175965.1.34453 WP_000175965.1.34454 WP_000175965.1.34458 WP_000175965.1.345 WP_000175965.1.34610 WP_000175965.1.34614 WP_000175965.1.34647 WP_000175965.1.34659 WP_000175965.1.34667 WP_000175965.1.34684 WP_000175965.1.34703 WP_000175965.1.34704 WP_000175965.1.34707 WP_000175965.1.34711 WP_000175965.1.34745 WP_000175965.1.3476 WP_000175965.1.34801 WP_000175965.1.34817 WP_000175965.1.34820 WP_000175965.1.34854 WP_000175965.1.34856 WP_000175965.1.34881 WP_000175965.1.34972 WP_000175965.1.34975 WP_000175965.1.34977 WP_000175965.1.35035 WP_000175965.1.35045 WP_000175965.1.35075 WP_000175965.1.35125 WP_000175965.1.35129 WP_000175965.1.35184 WP_000175965.1.35193 WP_000175965.1.35294 WP_000175965.1.35298 WP_000175965.1.35321 WP_000175965.1.35331 WP_000175965.1.35332 WP_000175965.1.35371 WP_000175965.1.35404 WP_000175965.1.35408 WP_000175965.1.3541 WP_000175965.1.35425 WP_000175965.1.35429 WP_000175965.1.35446 WP_000175965.1.35460 WP_000175965.1.35463 WP_000175965.1.35503 WP_000175965.1.35507 WP_000175965.1.35509 WP_000175965.1.3556 WP_000175965.1.35563 WP_000175965.1.35570 WP_000175965.1.35575 WP_000175965.1.35590 WP_000175965.1.35594 WP_000175965.1.35619 WP_000175965.1.35624 WP_000175965.1.35648 WP_000175965.1.3566 WP_000175965.1.3572 WP_000175965.1.35809 WP_000175965.1.35835 WP_000175965.1.35847 WP_000175965.1.35868 WP_000175965.1.35887 WP_000175965.1.35892 WP_000175965.1.35936 WP_000175965.1.35940 WP_000175965.1.35993 WP_000175965.1.36003 WP_000175965.1.3601 WP_000175965.1.36011 WP_000175965.1.36017 WP_000175965.1.36037 WP_000175965.1.36057 WP_000175965.1.36063 WP_000175965.1.3610 WP_000175965.1.36157 WP_000175965.1.36172 WP_000175965.1.36229 WP_000175965.1.36232 WP_000175965.1.36236 WP_000175965.1.36409 WP_000175965.1.36425 WP_000175965.1.36445 WP_000175965.1.36547 WP_000175965.1.36564 WP_000175965.1.36584 WP_000175965.1.36586 WP_000175965.1.36592 WP_000175965.1.36609 WP_000175965.1.36685 WP_000175965.1.36690 WP_000175965.1.3670 WP_000175965.1.36721 WP_000175965.1.36751 WP_000175965.1.36764 WP_000175965.1.36765 WP_000175965.1.36792 WP_000175965.1.36839 WP_000175965.1.36875 WP_000175965.1.3688 WP_000175965.1.36885 WP_000175965.1.36889 WP_000175965.1.36918 WP_000175965.1.36931 WP_000175965.1.36948 WP_000175965.1.36949 WP_000175965.1.36978 WP_000175965.1.37013 WP_000175965.1.37021 WP_000175965.1.37028 WP_000175965.1.37029 WP_000175965.1.37063 WP_000175965.1.37073 WP_000175965.1.37100 WP_000175965.1.37111 WP_000175965.1.37112 WP_000175965.1.37114 WP_000175965.1.37147 WP_000175965.1.37158 WP_000175965.1.37190 WP_000175965.1.37191 WP_000175965.1.37256 WP_000175965.1.3726 WP_000175965.1.3728 WP_000175965.1.37293 WP_000175965.1.37297 WP_000175965.1.37351 WP_000175965.1.37363 WP_000175965.1.37370 WP_000175965.1.37376 WP_000175965.1.37405 WP_000175965.1.3741 WP_000175965.1.3744 WP_000175965.1.37478 WP_000175965.1.3748 WP_000175965.1.37498 WP_000175965.1.37504 WP_000175965.1.3751 WP_000175965.1.37521 WP_000175965.1.37558 WP_000175965.1.3756 WP_000175965.1.37618 WP_000175965.1.37666 WP_000175965.1.37687 WP_000175965.1.3771 WP_000175965.1.37719 WP_000175965.1.3778 WP_000175965.1.37808 WP_000175965.1.37848 WP_000175965.1.37864 WP_000175965.1.3790 WP_000175965.1.37968 WP_000175965.1.37978 WP_000175965.1.38001 WP_000175965.1.38026 WP_000175965.1.38037 WP_000175965.1.38047 WP_000175965.1.38055 WP_000175965.1.38113 WP_000175965.1.38125 WP_000175965.1.38145 WP_000175965.1.38199 WP_000175965.1.3828 WP_000175965.1.38322 WP_000175965.1.38341 WP_000175965.1.38344 WP_000175965.1.38349 WP_000175965.1.38393 WP_000175965.1.38408 WP_000175965.1.38452 WP_000175965.1.3848 WP_000175965.1.38512 WP_000175965.1.38569 WP_000175965.1.38609 WP_000175965.1.38613 WP_000175965.1.38620 WP_000175965.1.38622 WP_000175965.1.38673 WP_000175965.1.3869 WP_000175965.1.38693 WP_000175965.1.38773 WP_000175965.1.38781 WP_000175965.1.38797 WP_000175965.1.38830 WP_000175965.1.38857 WP_000175965.1.38881 WP_000175965.1.38882 WP_000175965.1.38886 WP_000175965.1.38895 WP_000175965.1.38898 WP_000175965.1.38913 WP_000175965.1.38942 WP_000175965.1.38995 WP_000175965.1.39003 WP_000175965.1.39048 WP_000175965.1.39055 WP_000175965.1.39059 WP_000175965.1.39065 WP_000175965.1.39075 WP_000175965.1.39082 WP_000175965.1.39112 WP_000175965.1.39113 WP_000175965.1.39128 WP_000175965.1.39136 WP_000175965.1.39140 WP_000175965.1.39183 WP_000175965.1.39197 WP_000175965.1.39229 WP_000175965.1.39265 WP_000175965.1.39275 WP_000175965.1.39311 WP_000175965.1.39312 WP_000175965.1.39385 WP_000175965.1.39395 WP_000175965.1.39405 WP_000175965.1.39414 WP_000175965.1.39420 WP_000175965.1.39449 WP_000175965.1.39466 WP_000175965.1.39471 WP_000175965.1.39512 WP_000175965.1.39556 WP_000175965.1.39576 WP_000175965.1.39584 WP_000175965.1.39609 WP_000175965.1.39614 WP_000175965.1.39629 WP_000175965.1.39722 WP_000175965.1.39723 WP_000175965.1.39724 WP_000175965.1.39763 WP_000175965.1.39808 WP_000175965.1.39862 WP_000175965.1.39921 WP_000175965.1.39923 WP_000175965.1.39953 WP_000175965.1.40008 WP_000175965.1.40017 WP_000175965.1.40025 WP_000175965.1.40031 WP_000175965.1.40072 WP_000175965.1.40073 WP_000175965.1.40081 WP_000175965.1.4011 WP_000175965.1.40155 WP_000175965.1.40158 WP_000175965.1.40171 WP_000175965.1.40205 WP_000175965.1.40208 WP_000175965.1.40224 WP_000175965.1.40229 WP_000175965.1.40240 WP_000175965.1.40254 WP_000175965.1.40257 WP_000175965.1.40258 WP_000175965.1.40259 WP_000175965.1.40292 WP_000175965.1.40305 WP_000175965.1.40307 WP_000175965.1.40311 WP_000175965.1.40341 WP_000175965.1.4037 WP_000175965.1.40374 WP_000175965.1.40380 WP_000175965.1.40395 WP_000175965.1.40414 WP_000175965.1.40465 WP_000175965.1.40492 WP_000175965.1.40493 WP_000175965.1.40508 WP_000175965.1.40528 WP_000175965.1.40533 WP_000175965.1.40577 WP_000175965.1.40583 WP_000175965.1.40605 WP_000175965.1.40622 WP_000175965.1.40648 WP_000175965.1.40688 WP_000175965.1.40693 WP_000175965.1.40695 WP_000175965.1.40710 WP_000175965.1.40722 WP_000175965.1.40745 WP_000175965.1.4075 WP_000175965.1.40771 WP_000175965.1.40788 WP_000175965.1.40849 WP_000175965.1.4087 WP_000175965.1.40877 WP_000175965.1.4088 WP_000175965.1.40910 WP_000175965.1.40930 WP_000175965.1.40935 WP_000175965.1.40973 WP_000175965.1.40979 WP_000175965.1.40996 WP_000175965.1.41017 WP_000175965.1.41018 WP_000175965.1.41048 WP_000175965.1.41050 WP_000175965.1.41086 WP_000175965.1.4109 WP_000175965.1.41091 WP_000175965.1.41116 WP_000175965.1.41128 WP_000175965.1.41192 WP_000175965.1.41225 WP_000175965.1.41226 WP_000175965.1.41265 WP_000175965.1.41277 WP_000175965.1.41279 WP_000175965.1.41308 WP_000175965.1.41310 WP_000175965.1.41345 WP_000175965.1.41375 WP_000175965.1.4141 WP_000175965.1.41427 WP_000175965.1.41434 WP_000175965.1.41438 WP_000175965.1.41440 WP_000175965.1.41468 WP_000175965.1.41497 WP_000175965.1.41516 WP_000175965.1.41528 WP_000175965.1.41554 WP_000175965.1.41572 WP_000175965.1.41591 WP_000175965.1.41593 WP_000175965.1.41610 WP_000175965.1.41628 WP_000175965.1.41662 WP_000175965.1.41688 WP_000175965.1.41690 WP_000175965.1.41708 WP_000175965.1.41735 WP_000175965.1.41761 WP_000175965.1.41789 WP_000175965.1.41799 WP_000175965.1.4184 WP_000175965.1.41859 WP_000175965.1.41877 WP_000175965.1.41882 WP_000175965.1.41897 WP_000175965.1.41904 WP_000175965.1.41911 WP_000175965.1.41938 WP_000175965.1.41949 WP_000175965.1.41978 WP_000175965.1.41979 WP_000175965.1.41985 WP_000175965.1.41994 WP_000175965.1.42098 WP_000175965.1.42104 WP_000175965.1.42109 WP_000175965.1.42136 WP_000175965.1.42156 WP_000175965.1.422 WP_000175965.1.4222 WP_000175965.1.42243 WP_000175965.1.42244 WP_000175965.1.42248 WP_000175965.1.42263 WP_000175965.1.42276 WP_000175965.1.4229 WP_000175965.1.42320 WP_000175965.1.42322 WP_000175965.1.42328 WP_000175965.1.42342 WP_000175965.1.42356 WP_000175965.1.42372 WP_000175965.1.4239 WP_000175965.1.42392 WP_000175965.1.42404 WP_000175965.1.42422 WP_000175965.1.42433 WP_000175965.1.42444 WP_000175965.1.42453 WP_000175965.1.42491 WP_000175965.1.4257 WP_000175965.1.42605 WP_000175965.1.42655 WP_000175965.1.42666 WP_000175965.1.42675 WP_000175965.1.42676 WP_000175965.1.42683 WP_000175965.1.42707 WP_000175965.1.42734 WP_000175965.1.4276 WP_000175965.1.42767 WP_000175965.1.42794 WP_000175965.1.42797 WP_000175965.1.42829 WP_000175965.1.42861 WP_000175965.1.42864 WP_000175965.1.4288 WP_000175965.1.42887 WP_000175965.1.4289 WP_000175965.1.42892 WP_000175965.1.42923 WP_000175965.1.42932 WP_000175965.1.42957 WP_000175965.1.42978 WP_000175965.1.43018 WP_000175965.1.43041 WP_000175965.1.43070 WP_000175965.1.43077 WP_000175965.1.43086 WP_000175965.1.43089 WP_000175965.1.43126 WP_000175965.1.43160 WP_000175965.1.43201 WP_000175965.1.43244 WP_000175965.1.43258 WP_000175965.1.43272 WP_000175965.1.43276 WP_000175965.1.43299 WP_000175965.1.43312 WP_000175965.1.4332 WP_000175965.1.43334 WP_000175965.1.43339 WP_000175965.1.43351 WP_000175965.1.43371 WP_000175965.1.43437 WP_000175965.1.43438 WP_000175965.1.4344 WP_000175965.1.43441 WP_000175965.1.43476 WP_000175965.1.43520 WP_000175965.1.43522 WP_000175965.1.43528 WP_000175965.1.43535 WP_000175965.1.43606 WP_000175965.1.43613 WP_000175965.1.43654 WP_000175965.1.43668 WP_000175965.1.43676 WP_000175965.1.43685 WP_000175965.1.43710 WP_000175965.1.43711 WP_000175965.1.4373 WP_000175965.1.43763 WP_000175965.1.43778 WP_000175965.1.43785 WP_000175965.1.43828 WP_000175965.1.43839 WP_000175965.1.43864 WP_000175965.1.43873 WP_000175965.1.43875 WP_000175965.1.43886 WP_000175965.1.43951 WP_000175965.1.43954 WP_000175965.1.44005 WP_000175965.1.44010 WP_000175965.1.4404 WP_000175965.1.44043 WP_000175965.1.4405 WP_000175965.1.44063 WP_000175965.1.44099 WP_000175965.1.44121 WP_000175965.1.44132 WP_000175965.1.44144 WP_000175965.1.44191 WP_000175965.1.4422 WP_000175965.1.4423 WP_000175965.1.44250 WP_000175965.1.44291 WP_000175965.1.44300 WP_000175965.1.44310 WP_000175965.1.44337 WP_000175965.1.44339 WP_000175965.1.44380 WP_000175965.1.44386 WP_000175965.1.44397 WP_000175965.1.4440 WP_000175965.1.44433 WP_000175965.1.44438 WP_000175965.1.44440 WP_000175965.1.44443 WP_000175965.1.44453 WP_000175965.1.44474 WP_000175965.1.44479 WP_000175965.1.44549 WP_000175965.1.44606 WP_000175965.1.44607 WP_000175965.1.44633 WP_000175965.1.44636 WP_000175965.1.44640 WP_000175965.1.4467 WP_000175965.1.44678 WP_000175965.1.44687 WP_000175965.1.44705 WP_000175965.1.44747 WP_000175965.1.44781 WP_000175965.1.44791 WP_000175965.1.44795 WP_000175965.1.44831 WP_000175965.1.44833 WP_000175965.1.44887 WP_000175965.1.449 WP_000175965.1.44927 WP_000175965.1.44933 WP_000175965.1.44943 WP_000175965.1.44950 WP_000175965.1.44966 WP_000175965.1.44971 WP_000175965.1.44978 WP_000175965.1.44985 WP_000175965.1.44996 WP_000175965.1.44997 WP_000175965.1.44998 WP_000175965.1.4500 WP_000175965.1.45038 WP_000175965.1.4505 WP_000175965.1.45067 WP_000175965.1.45074 WP_000175965.1.45079 WP_000175965.1.45098 WP_000175965.1.45134 WP_000175965.1.45138 WP_000175965.1.45145 WP_000175965.1.45154 WP_000175965.1.45173 WP_000175965.1.45177 WP_000175965.1.45184 WP_000175965.1.45229 WP_000175965.1.45238 WP_000175965.1.45259 WP_000175965.1.45302 WP_000175965.1.4531 WP_000175965.1.45344 WP_000175965.1.45349 WP_000175965.1.45351 WP_000175965.1.45365 WP_000175965.1.4540 WP_000175965.1.45402 WP_000175965.1.45432 WP_000175965.1.45434 WP_000175965.1.45462 WP_000175965.1.45522 WP_000175965.1.45535 WP_000175965.1.45544 WP_000175965.1.45549 WP_000175965.1.45550 WP_000175965.1.45566 WP_000175965.1.45569 WP_000175965.1.45571 WP_000175965.1.45582 WP_000175965.1.45583 WP_000175965.1.45585 WP_000175965.1.45622 WP_000175965.1.45660 WP_000175965.1.45690 WP_000175965.1.45797 WP_000175965.1.458 WP_000175965.1.45844 WP_000175965.1.45848 WP_000175965.1.45906 WP_000175965.1.45918 WP_000175965.1.4592 WP_000175965.1.45943 WP_000175965.1.45973 WP_000175965.1.45984 WP_000175965.1.46011 WP_000175965.1.46028 WP_000175965.1.46069 WP_000175965.1.46091 WP_000175965.1.46112 WP_000175965.1.46173 WP_000175965.1.46174 WP_000175965.1.46187 WP_000175965.1.46203 WP_000175965.1.46205 WP_000175965.1.46215 WP_000175965.1.46232 WP_000175965.1.46243 WP_000175965.1.46250 WP_000175965.1.46278 WP_000175965.1.46286 WP_000175965.1.46299 WP_000175965.1.46303 WP_000175965.1.46322 WP_000175965.1.46323 WP_000175965.1.46345 WP_000175965.1.46358 WP_000175965.1.46406 WP_000175965.1.46434 WP_000175965.1.46444 WP_000175965.1.46572 WP_000175965.1.46574 WP_000175965.1.46578 WP_000175965.1.46595 WP_000175965.1.46620 WP_000175965.1.46637 WP_000175965.1.46666 WP_000175965.1.46675 WP_000175965.1.46689 WP_000175965.1.46693 WP_000175965.1.4671 WP_000175965.1.46726 WP_000175965.1.46730 WP_000175965.1.46732 WP_000175965.1.4674 WP_000175965.1.46749 WP_000175965.1.46803 WP_000175965.1.46804 WP_000175965.1.4686 WP_000175965.1.46930 WP_000175965.1.46961 WP_000175965.1.46967 WP_000175965.1.46976 WP_000175965.1.47008 WP_000175965.1.47014 WP_000175965.1.47023 WP_000175965.1.47057 WP_000175965.1.47061 WP_000175965.1.47067 WP_000175965.1.47110 WP_000175965.1.47214 WP_000175965.1.47243 WP_000175965.1.47389 WP_000175965.1.47429 WP_000175965.1.47442 WP_000175965.1.47448 WP_000175965.1.47460 WP_000175965.1.4747 WP_000175965.1.47472 WP_000175965.1.47478 WP_000175965.1.47482 WP_000175965.1.47492 WP_000175965.1.47507 WP_000175965.1.47542 WP_000175965.1.47567 WP_000175965.1.47576 WP_000175965.1.47579 WP_000175965.1.4758 WP_000175965.1.47587 WP_000175965.1.47614 WP_000175965.1.47621 WP_000175965.1.47660 WP_000175965.1.4769 WP_000175965.1.4770 WP_000175965.1.47714 WP_000175965.1.4775 WP_000175965.1.47767 WP_000175965.1.47799 WP_000175965.1.47814 WP_000175965.1.47817 WP_000175965.1.47829 WP_000175965.1.47849 WP_000175965.1.47850 WP_000175965.1.47875 WP_000175965.1.47902 WP_000175965.1.47911 WP_000175965.1.4795 WP_000175965.1.47988 WP_000175965.1.48033 WP_000175965.1.48124 WP_000175965.1.48132 WP_000175965.1.48134 WP_000175965.1.48209 WP_000175965.1.48242 WP_000175965.1.48244 WP_000175965.1.48253 WP_000175965.1.48262 WP_000175965.1.48268 WP_000175965.1.483 WP_000175965.1.48367 WP_000175965.1.48377 WP_000175965.1.4839 WP_000175965.1.48399 WP_000175965.1.48510 WP_000175965.1.4853 WP_000175965.1.48570 WP_000175965.1.48647 WP_000175965.1.48651 WP_000175965.1.48751 WP_000175965.1.48768 WP_000175965.1.48774 WP_000175965.1.48788 WP_000175965.1.48797 WP_000175965.1.48841 WP_000175965.1.4885 WP_000175965.1.48855 WP_000175965.1.48886 WP_000175965.1.48894 WP_000175965.1.48896 WP_000175965.1.48908 WP_000175965.1.48918 WP_000175965.1.48919 WP_000175965.1.48931 WP_000175965.1.48985 WP_000175965.1.49005 WP_000175965.1.49012 WP_000175965.1.49084 WP_000175965.1.49090 WP_000175965.1.49102 WP_000175965.1.49113 WP_000175965.1.49155 WP_000175965.1.49162 WP_000175965.1.49175 WP_000175965.1.49204 WP_000175965.1.49214 WP_000175965.1.49226 WP_000175965.1.49233 WP_000175965.1.49239 WP_000175965.1.49256 WP_000175965.1.49274 WP_000175965.1.49276 WP_000175965.1.49290 WP_000175965.1.49302 WP_000175965.1.49304 WP_000175965.1.49309 WP_000175965.1.49311 WP_000175965.1.49334 WP_000175965.1.49340 WP_000175965.1.49358 WP_000175965.1.49366 WP_000175965.1.49375 WP_000175965.1.49430 WP_000175965.1.49443 WP_000175965.1.49472 WP_000175965.1.49490 WP_000175965.1.49494 WP_000175965.1.49515 WP_000175965.1.49534 WP_000175965.1.49550 WP_000175965.1.49572 WP_000175965.1.49574 WP_000175965.1.49590 WP_000175965.1.49602 WP_000175965.1.49626 WP_000175965.1.49630 WP_000175965.1.49647 WP_000175965.1.49650 WP_000175965.1.49710 WP_000175965.1.49770 WP_000175965.1.49778 WP_000175965.1.49780 WP_000175965.1.4979 WP_000175965.1.49790 WP_000175965.1.49803 WP_000175965.1.49805 WP_000175965.1.49827 WP_000175965.1.49848 WP_000175965.1.49929 WP_000175965.1.49931 WP_000175965.1.50003 WP_000175965.1.50007 WP_000175965.1.50080 WP_000175965.1.5009 WP_000175965.1.50128 WP_000175965.1.50153 WP_000175965.1.50161 WP_000175965.1.50198 WP_000175965.1.50211 WP_000175965.1.50238 WP_000175965.1.50251 WP_000175965.1.50285 WP_000175965.1.50332 WP_000175965.1.50349 WP_000175965.1.50374 WP_000175965.1.50376 WP_000175965.1.50389 WP_000175965.1.50404 WP_000175965.1.50413 WP_000175965.1.50449 WP_000175965.1.50469 WP_000175965.1.50478 WP_000175965.1.50480 WP_000175965.1.50497 WP_000175965.1.50517 WP_000175965.1.50529 WP_000175965.1.50563 WP_000175965.1.5058 WP_000175965.1.50593 WP_000175965.1.50652 WP_000175965.1.50676 WP_000175965.1.50684 WP_000175965.1.50750 WP_000175965.1.50769 WP_000175965.1.50777 WP_000175965.1.50804 WP_000175965.1.50808 WP_000175965.1.50811 WP_000175965.1.5088 WP_000175965.1.50882 WP_000175965.1.50893 WP_000175965.1.50905 WP_000175965.1.50908 WP_000175965.1.50918 WP_000175965.1.50941 WP_000175965.1.50954 WP_000175965.1.50960 WP_000175965.1.50999 WP_000175965.1.51014 WP_000175965.1.51022 WP_000175965.1.51025 WP_000175965.1.51066 WP_000175965.1.51117 WP_000175965.1.5114 WP_000175965.1.51178 WP_000175965.1.51179 WP_000175965.1.51182 WP_000175965.1.51186 WP_000175965.1.51224 WP_000175965.1.5125 WP_000175965.1.51285 WP_000175965.1.51308 WP_000175965.1.51331 WP_000175965.1.51338 WP_000175965.1.51356 WP_000175965.1.5138 WP_000175965.1.51394 WP_000175965.1.51412 WP_000175965.1.51414 WP_000175965.1.51419 WP_000175965.1.51451 WP_000175965.1.51487 WP_000175965.1.51488 WP_000175965.1.51502 WP_000175965.1.51514 WP_000175965.1.51555 WP_000175965.1.51611 WP_000175965.1.51613 WP_000175965.1.51615 WP_000175965.1.51634 WP_000175965.1.51642 WP_000175965.1.51649 WP_000175965.1.51686 WP_000175965.1.51700 WP_000175965.1.51704 WP_000175965.1.51756 WP_000175965.1.51764 WP_000175965.1.51810 WP_000175965.1.51831 WP_000175965.1.5185 WP_000175965.1.51868 WP_000175965.1.51888 WP_000175965.1.51900 WP_000175965.1.51910 WP_000175965.1.51911 WP_000175965.1.51930 WP_000175965.1.51932 WP_000175965.1.51989 WP_000175965.1.51994 WP_000175965.1.520 WP_000175965.1.52047 WP_000175965.1.52101 WP_000175965.1.5211 WP_000175965.1.52121 WP_000175965.1.52148 WP_000175965.1.52156 WP_000175965.1.52161 WP_000175965.1.52170 WP_000175965.1.52255 WP_000175965.1.52301 WP_000175965.1.52321 WP_000175965.1.52336 WP_000175965.1.52346 WP_000175965.1.52356 WP_000175965.1.52361 WP_000175965.1.52438 WP_000175965.1.52446 WP_000175965.1.52456 WP_000175965.1.52527 WP_000175965.1.52528 WP_000175965.1.52582 WP_000175965.1.52586 WP_000175965.1.52608 WP_000175965.1.52637 WP_000175965.1.52653 WP_000175965.1.52656 WP_000175965.1.52675 WP_000175965.1.52692 WP_000175965.1.5273 WP_000175965.1.52738 WP_000175965.1.52743 WP_000175965.1.52744 WP_000175965.1.52748 WP_000175965.1.52824 WP_000175965.1.52833 WP_000175965.1.52851 WP_000175965.1.52857 WP_000175965.1.52858 WP_000175965.1.52866 WP_000175965.1.52898 WP_000175965.1.52910 WP_000175965.1.52915 WP_000175965.1.52924 WP_000175965.1.52949 WP_000175965.1.52985 WP_000175965.1.5301 WP_000175965.1.53016 WP_000175965.1.53100 WP_000175965.1.53107 WP_000175965.1.53119 WP_000175965.1.5313 WP_000175965.1.53158 WP_000175965.1.5316 WP_000175965.1.53179 WP_000175965.1.53190 WP_000175965.1.53198 WP_000175965.1.53203 WP_000175965.1.53206 WP_000175965.1.53234 WP_000175965.1.53272 WP_000175965.1.53274 WP_000175965.1.53315 WP_000175965.1.53328 WP_000175965.1.53362 WP_000175965.1.53385 WP_000175965.1.53406 WP_000175965.1.53436 WP_000175965.1.53466 WP_000175965.1.53529 WP_000175965.1.53534 WP_000175965.1.53543 WP_000175965.1.53567 WP_000175965.1.53664 WP_000175965.1.53694 WP_000175965.1.53696 WP_000175965.1.53757 WP_000175965.1.53772 WP_000175965.1.53778 WP_000175965.1.53781 WP_000175965.1.53790 WP_000175965.1.53812 WP_000175965.1.53814 WP_000175965.1.53896 WP_000175965.1.53905 WP_000175965.1.5392 WP_000175965.1.53935 WP_000175965.1.54033 WP_000175965.1.54061 WP_000175965.1.54075 WP_000175965.1.54082 WP_000175965.1.54085 WP_000175965.1.5415 WP_000175965.1.54159 WP_000175965.1.54196 WP_000175965.1.542 WP_000175965.1.54209 WP_000175965.1.54271 WP_000175965.1.54273 WP_000175965.1.54274 WP_000175965.1.54283 WP_000175965.1.54319 WP_000175965.1.54324 WP_000175965.1.54333 WP_000175965.1.54340 WP_000175965.1.54364 WP_000175965.1.54366 WP_000175965.1.54400 WP_000175965.1.54469 WP_000175965.1.54500 WP_000175965.1.54522 WP_000175965.1.54526 WP_000175965.1.54558 WP_000175965.1.5456 WP_000175965.1.54569 WP_000175965.1.5459 WP_000175965.1.54607 WP_000175965.1.54615 WP_000175965.1.5462 WP_000175965.1.54644 WP_000175965.1.54662 WP_000175965.1.54694 WP_000175965.1.54722 WP_000175965.1.54749 WP_000175965.1.54764 WP_000175965.1.54774 WP_000175965.1.54814 WP_000175965.1.54822 WP_000175965.1.54827 WP_000175965.1.54833 WP_000175965.1.54845 WP_000175965.1.5485 WP_000175965.1.54877 WP_000175965.1.5493 WP_000175965.1.54936 WP_000175965.1.54992 WP_000175965.1.55008 WP_000175965.1.55073 WP_000175965.1.55152 WP_000175965.1.55156 WP_000175965.1.55166 WP_000175965.1.5517 WP_000175965.1.55178 WP_000175965.1.55200 WP_000175965.1.55223 WP_000175965.1.5523 WP_000175965.1.5525 WP_000175965.1.5527 WP_000175965.1.55285 WP_000175965.1.55294 WP_000175965.1.55325 WP_000175965.1.55361 WP_000175965.1.55418 WP_000175965.1.55430 WP_000175965.1.55475 WP_000175965.1.55477 WP_000175965.1.55496 WP_000175965.1.55500 WP_000175965.1.5552 WP_000175965.1.55528 WP_000175965.1.55545 WP_000175965.1.5555 WP_000175965.1.55554 WP_000175965.1.55557 WP_000175965.1.55559 WP_000175965.1.5560 WP_000175965.1.55614 WP_000175965.1.55623 WP_000175965.1.55640 WP_000175965.1.55647 WP_000175965.1.55672 WP_000175965.1.55680 WP_000175965.1.55706 WP_000175965.1.55718 WP_000175965.1.5572 WP_000175965.1.55743 WP_000175965.1.55768 WP_000175965.1.5577 WP_000175965.1.55782 WP_000175965.1.55796 WP_000175965.1.55803 WP_000175965.1.55853 WP_000175965.1.55923 WP_000175965.1.55948 WP_000175965.1.55973 WP_000175965.1.55993 WP_000175965.1.55995 WP_000175965.1.56002 WP_000175965.1.56004 WP_000175965.1.56012 WP_000175965.1.56026 WP_000175965.1.56069 WP_000175965.1.56070 WP_000175965.1.56082 WP_000175965.1.56097 WP_000175965.1.56100 WP_000175965.1.56105 WP_000175965.1.56130 WP_000175965.1.56152 WP_000175965.1.56222 WP_000175965.1.56235 WP_000175965.1.56238 WP_000175965.1.56244 WP_000175965.1.56247 WP_000175965.1.56263 WP_000175965.1.56286 WP_000175965.1.56303 WP_000175965.1.56304 WP_000175965.1.5633 WP_000175965.1.56354 WP_000175965.1.56368 WP_000175965.1.56370 WP_000175965.1.56374 WP_000175965.1.56389 WP_000175965.1.56393 WP_000175965.1.56396 WP_000175965.1.56413 WP_000175965.1.56414 WP_000175965.1.56420 WP_000175965.1.56438 WP_000175965.1.56459 WP_000175965.1.56468 WP_000175965.1.56559 WP_000175965.1.56560 WP_000175965.1.56601 WP_000175965.1.56614 WP_000175965.1.56615 WP_000175965.1.56642 WP_000175965.1.56647 WP_000175965.1.56651 WP_000175965.1.56660 WP_000175965.1.56671 WP_000175965.1.5668 WP_000175965.1.56682 WP_000175965.1.56791 WP_000175965.1.56824 WP_000175965.1.56851 WP_000175965.1.56853 WP_000175965.1.56861 WP_000175965.1.56875 WP_000175965.1.56877 WP_000175965.1.56893 WP_000175965.1.56898 WP_000175965.1.56905 WP_000175965.1.56942 WP_000175965.1.56950 WP_000175965.1.57000 WP_000175965.1.57026 WP_000175965.1.57039 WP_000175965.1.57056 WP_000175965.1.57076 WP_000175965.1.57084 WP_000175965.1.5711 WP_000175965.1.57125 WP_000175965.1.57143 WP_000175965.1.57149 WP_000175965.1.57168 WP_000175965.1.57187 WP_000175965.1.57232 WP_000175965.1.57233 WP_000175965.1.57244 WP_000175965.1.57246 WP_000175965.1.57296 WP_000175965.1.57307 WP_000175965.1.57344 WP_000175965.1.57356 WP_000175965.1.57357 WP_000175965.1.57362 WP_000175965.1.57377 WP_000175965.1.57418 WP_000175965.1.57433 WP_000175965.1.57494 WP_000175965.1.57495 WP_000175965.1.57510 WP_000175965.1.57515 WP_000175965.1.57529 WP_000175965.1.57534 WP_000175965.1.57555 WP_000175965.1.57559 WP_000175965.1.57576 WP_000175965.1.57601 WP_000175965.1.57607 WP_000175965.1.5761 WP_000175965.1.57631 WP_000175965.1.57641 WP_000175965.1.57709 WP_000175965.1.57710 WP_000175965.1.57735 WP_000175965.1.5774 WP_000175965.1.57763 WP_000175965.1.57778 WP_000175965.1.57781 WP_000175965.1.57797 WP_000175965.1.57835 WP_000175965.1.57857 WP_000175965.1.57862 WP_000175965.1.57890 WP_000175965.1.57891 WP_000175965.1.57893 WP_000175965.1.57902 WP_000175965.1.57978 WP_000175965.1.5801 WP_000175965.1.58040 WP_000175965.1.58041 WP_000175965.1.58053 WP_000175965.1.58090 WP_000175965.1.58131 WP_000175965.1.58144 WP_000175965.1.58153 WP_000175965.1.58157 WP_000175965.1.58239 WP_000175965.1.58249 WP_000175965.1.58251 WP_000175965.1.5828 WP_000175965.1.58290 WP_000175965.1.58301 WP_000175965.1.58334 WP_000175965.1.58357 WP_000175965.1.58358 WP_000175965.1.58372 WP_000175965.1.58407 WP_000175965.1.58416 WP_000175965.1.58418 WP_000175965.1.58442 WP_000175965.1.58443 WP_000175965.1.58451 WP_000175965.1.5846 WP_000175965.1.58467 WP_000175965.1.58486 WP_000175965.1.58489 WP_000175965.1.5854 WP_000175965.1.58548 WP_000175965.1.58564 WP_000175965.1.5858 WP_000175965.1.58604 WP_000175965.1.58633 WP_000175965.1.58648 WP_000175965.1.58662 WP_000175965.1.58669 WP_000175965.1.58675 WP_000175965.1.58698 WP_000175965.1.587 WP_000175965.1.58744 WP_000175965.1.58745 WP_000175965.1.58749 WP_000175965.1.58770 WP_000175965.1.58803 WP_000175965.1.58831 WP_000175965.1.58834 WP_000175965.1.58836 WP_000175965.1.5886 WP_000175965.1.58884 WP_000175965.1.58926 WP_000175965.1.58932 WP_000175965.1.59006 WP_000175965.1.59012 WP_000175965.1.59068 WP_000175965.1.59094 WP_000175965.1.59097 WP_000175965.1.59125 WP_000175965.1.59136 WP_000175965.1.59142 WP_000175965.1.59148 WP_000175965.1.59163 WP_000175965.1.59224 WP_000175965.1.59236 WP_000175965.1.59276 WP_000175965.1.5929 WP_000175965.1.59294 WP_000175965.1.59295 WP_000175965.1.59321 WP_000175965.1.59335 WP_000175965.1.59336 WP_000175965.1.59375 WP_000175965.1.59381 WP_000175965.1.59412 WP_000175965.1.59420 WP_000175965.1.59427 WP_000175965.1.59439 WP_000175965.1.59458 WP_000175965.1.59486 WP_000175965.1.59490 WP_000175965.1.59508 WP_000175965.1.59512 WP_000175965.1.59521 WP_000175965.1.5953 WP_000175965.1.59538 WP_000175965.1.59548 WP_000175965.1.59562 WP_000175965.1.59587 WP_000175965.1.59604 WP_000175965.1.59636 WP_000175965.1.59641 WP_000175965.1.59646 WP_000175965.1.59648 WP_000175965.1.59684 WP_000175965.1.59694 WP_000175965.1.59755 WP_000175965.1.59771 WP_000175965.1.5979 WP_000175965.1.59830 WP_000175965.1.59848 WP_000175965.1.59928 WP_000175965.1.5993 WP_000175965.1.59953 WP_000175965.1.59979 WP_000175965.1.60004 WP_000175965.1.60008 WP_000175965.1.60015 WP_000175965.1.60021 WP_000175965.1.60069 WP_000175965.1.60106 WP_000175965.1.60126 WP_000175965.1.60137 WP_000175965.1.60140 WP_000175965.1.60155 WP_000175965.1.60209 WP_000175965.1.60213 WP_000175965.1.60226 WP_000175965.1.60285 WP_000175965.1.60320 WP_000175965.1.6033 WP_000175965.1.60330 WP_000175965.1.60370 WP_000175965.1.60379 WP_000175965.1.60425 WP_000175965.1.60464 WP_000175965.1.60469 WP_000175965.1.60486 WP_000175965.1.60503 WP_000175965.1.60507 WP_000175965.1.6052 WP_000175965.1.60545 WP_000175965.1.60560 WP_000175965.1.60561 WP_000175965.1.60597 WP_000175965.1.60608 WP_000175965.1.60622 WP_000175965.1.60713 WP_000175965.1.60746 WP_000175965.1.60760 WP_000175965.1.60772 WP_000175965.1.60794 WP_000175965.1.608 WP_000175965.1.60809 WP_000175965.1.60838 WP_000175965.1.60851 WP_000175965.1.60855 WP_000175965.1.60857 WP_000175965.1.6086 WP_000175965.1.60863 WP_000175965.1.60866 WP_000175965.1.60874 WP_000175965.1.60897 WP_000175965.1.6090 WP_000175965.1.60919 WP_000175965.1.60926 WP_000175965.1.60941 WP_000175965.1.60976 WP_000175965.1.60988 WP_000175965.1.60990 WP_000175965.1.61045 WP_000175965.1.61078 WP_000175965.1.6108 WP_000175965.1.61087 WP_000175965.1.61114 WP_000175965.1.6114 WP_000175965.1.61146 WP_000175965.1.61184 WP_000175965.1.61200 WP_000175965.1.61218 WP_000175965.1.61232 WP_000175965.1.61233 WP_000175965.1.6129 WP_000175965.1.61296 WP_000175965.1.61309 WP_000175965.1.61345 WP_000175965.1.61356 WP_000175965.1.61381 WP_000175965.1.61417 WP_000175965.1.6143 WP_000175965.1.61434 WP_000175965.1.61497 WP_000175965.1.61501 WP_000175965.1.61509 WP_000175965.1.61519 WP_000175965.1.61574 WP_000175965.1.61582 WP_000175965.1.61594 WP_000175965.1.61595 WP_000175965.1.61609 WP_000175965.1.6164 WP_000175965.1.61662 WP_000175965.1.61667 WP_000175965.1.61671 WP_000175965.1.61694 WP_000175965.1.61712 WP_000175965.1.61714 WP_000175965.1.61730 WP_000175965.1.61732 WP_000175965.1.61737 WP_000175965.1.61743 WP_000175965.1.61857 WP_000175965.1.6190 WP_000175965.1.61908 WP_000175965.1.61918 WP_000175965.1.61922 WP_000175965.1.61952 WP_000175965.1.61968 WP_000175965.1.62007 WP_000175965.1.62020 WP_000175965.1.62025 WP_000175965.1.62063 WP_000175965.1.62076 WP_000175965.1.6209 WP_000175965.1.6210 WP_000175965.1.62108 WP_000175965.1.62120 WP_000175965.1.62122 WP_000175965.1.62142 WP_000175965.1.62144 WP_000175965.1.62158 WP_000175965.1.62184 WP_000175965.1.62195 WP_000175965.1.62201 WP_000175965.1.62204 WP_000175965.1.62210 WP_000175965.1.62219 WP_000175965.1.62222 WP_000175965.1.62241 WP_000175965.1.62245 WP_000175965.1.62257 WP_000175965.1.62271 WP_000175965.1.62304 WP_000175965.1.62310 WP_000175965.1.62339 WP_000175965.1.62344 WP_000175965.1.62361 WP_000175965.1.62364 WP_000175965.1.62374 WP_000175965.1.62403 WP_000175965.1.62404 WP_000175965.1.62407 WP_000175965.1.62412 WP_000175965.1.62486 WP_000175965.1.62488 WP_000175965.1.62522 WP_000175965.1.6253 WP_000175965.1.62564 WP_000175965.1.62570 WP_000175965.1.62648 WP_000175965.1.62677 WP_000175965.1.62693 WP_000175965.1.627 WP_000175965.1.62725 WP_000175965.1.62745 WP_000175965.1.62757 WP_000175965.1.62798 WP_000175965.1.62828 WP_000175965.1.62853 WP_000175965.1.62903 WP_000175965.1.62910 WP_000175965.1.6292 WP_000175965.1.62955 WP_000175965.1.62976 WP_000175965.1.62983 WP_000175965.1.62988 WP_000175965.1.63043 WP_000175965.1.63045 WP_000175965.1.63063 WP_000175965.1.63102 WP_000175965.1.63118 WP_000175965.1.63129 WP_000175965.1.63135 WP_000175965.1.63150 WP_000175965.1.63181 WP_000175965.1.63186 WP_000175965.1.63203 WP_000175965.1.63229 WP_000175965.1.63234 WP_000175965.1.63243 WP_000175965.1.63250 WP_000175965.1.63256 WP_000175965.1.63290 WP_000175965.1.63358 WP_000175965.1.63382 WP_000175965.1.63422 WP_000175965.1.63432 WP_000175965.1.63455 WP_000175965.1.63461 WP_000175965.1.63479 WP_000175965.1.63497 WP_000175965.1.63499 WP_000175965.1.63509 WP_000175965.1.63513 WP_000175965.1.63529 WP_000175965.1.63532 WP_000175965.1.63568 WP_000175965.1.6357 WP_000175965.1.63585 WP_000175965.1.63603 WP_000175965.1.63633 WP_000175965.1.63664 WP_000175965.1.6367 WP_000175965.1.63690 WP_000175965.1.6370 WP_000175965.1.63718 WP_000175965.1.63748 WP_000175965.1.6375 WP_000175965.1.63757 WP_000175965.1.63766 WP_000175965.1.63781 WP_000175965.1.63782 WP_000175965.1.63797 WP_000175965.1.63824 WP_000175965.1.63831 WP_000175965.1.63834 WP_000175965.1.63851 WP_000175965.1.63860 WP_000175965.1.63863 WP_000175965.1.63864 WP_000175965.1.63866 WP_000175965.1.63912 WP_000175965.1.63934 WP_000175965.1.63958 WP_000175965.1.6399 WP_000175965.1.63992 WP_000175965.1.64007 WP_000175965.1.64010 WP_000175965.1.64018 WP_000175965.1.64034 WP_000175965.1.64046 WP_000175965.1.64072 WP_000175965.1.64085 WP_000175965.1.64103 WP_000175965.1.64109 WP_000175965.1.64121 WP_000175965.1.64157 WP_000175965.1.64176 WP_000175965.1.64208 WP_000175965.1.64229 WP_000175965.1.6423 WP_000175965.1.64242 WP_000175965.1.64244 WP_000175965.1.64266 WP_000175965.1.64294 WP_000175965.1.64350 WP_000175965.1.6437 WP_000175965.1.64374 WP_000175965.1.64385 WP_000175965.1.64387 WP_000175965.1.64389 WP_000175965.1.64403 WP_000175965.1.64412 WP_000175965.1.64462 WP_000175965.1.64500 WP_000175965.1.6451 WP_000175965.1.64569 WP_000175965.1.64597 WP_000175965.1.64645 WP_000175965.1.64649 WP_000175965.1.64674 WP_000175965.1.64690 WP_000175965.1.64702 WP_000175965.1.64711 WP_000175965.1.64757 WP_000175965.1.64758 WP_000175965.1.64771 WP_000175965.1.64781 WP_000175965.1.64798 WP_000175965.1.64831 WP_000175965.1.6484 WP_000175965.1.6489 WP_000175965.1.64894 WP_000175965.1.64944 WP_000175965.1.64972 WP_000175965.1.65011 WP_000175965.1.65016 WP_000175965.1.65018 WP_000175965.1.65022 WP_000175965.1.65027 WP_000175965.1.65028 WP_000175965.1.65052 WP_000175965.1.65168 WP_000175965.1.65171 WP_000175965.1.65238 WP_000175965.1.65248 WP_000175965.1.6525 WP_000175965.1.65269 WP_000175965.1.65295 WP_000175965.1.65348 WP_000175965.1.6535 WP_000175965.1.65357 WP_000175965.1.65363 WP_000175965.1.65394 WP_000175965.1.65437 WP_000175965.1.65471 WP_000175965.1.65474 WP_000175965.1.65475 WP_000175965.1.6550 WP_000175965.1.65508 WP_000175965.1.65538 WP_000175965.1.65558 WP_000175965.1.65572 WP_000175965.1.6560 WP_000175965.1.65601 WP_000175965.1.6561 WP_000175965.1.65620 WP_000175965.1.65633 WP_000175965.1.6565 WP_000175965.1.65687 WP_000175965.1.65696 WP_000175965.1.65698 WP_000175965.1.6572 WP_000175965.1.6575 WP_000175965.1.65771 WP_000175965.1.65782 WP_000175965.1.65790 WP_000175965.1.65795 WP_000175965.1.65818 WP_000175965.1.65838 WP_000175965.1.65849 WP_000175965.1.65881 WP_000175965.1.65883 WP_000175965.1.65901 WP_000175965.1.65940 WP_000175965.1.65945 WP_000175965.1.6595 WP_000175965.1.65956 WP_000175965.1.66049 WP_000175965.1.66082 WP_000175965.1.66085 WP_000175965.1.66122 WP_000175965.1.66129 WP_000175965.1.66167 WP_000175965.1.66171 WP_000175965.1.66235 WP_000175965.1.66250 WP_000175965.1.66289 WP_000175965.1.6630 WP_000175965.1.66314 WP_000175965.1.66315 WP_000175965.1.66330 WP_000175965.1.66358 WP_000175965.1.66362 WP_000175965.1.66365 WP_000175965.1.66368 WP_000175965.1.6638 WP_000175965.1.66385 WP_000175965.1.6640 WP_000175965.1.66400 WP_000175965.1.66428 WP_000175965.1.66446 WP_000175965.1.66462 WP_000175965.1.66492 WP_000175965.1.66534 WP_000175965.1.66539 WP_000175965.1.66600 WP_000175965.1.66630 WP_000175965.1.66678 WP_000175965.1.66698 WP_000175965.1.66702 WP_000175965.1.66733 WP_000175965.1.66779 WP_000175965.1.6680 WP_000175965.1.66800 WP_000175965.1.66807 WP_000175965.1.66824 WP_000175965.1.66825 WP_000175965.1.66834 WP_000175965.1.66876 WP_000175965.1.66901 WP_000175965.1.6692 WP_000175965.1.66937 WP_000175965.1.66959 WP_000175965.1.66962 WP_000175965.1.67 WP_000175965.1.67037 WP_000175965.1.67045 WP_000175965.1.67075 WP_000175965.1.6710 WP_000175965.1.67100 WP_000175965.1.67173 WP_000175965.1.67175 WP_000175965.1.67181 WP_000175965.1.67184 WP_000175965.1.67228 WP_000175965.1.67235 WP_000175965.1.67268 WP_000175965.1.67279 WP_000175965.1.67288 WP_000175965.1.67347 WP_000175965.1.67374 WP_000175965.1.6739 WP_000175965.1.67405 WP_000175965.1.67424 WP_000175965.1.67465 WP_000175965.1.67552 WP_000175965.1.6760 WP_000175965.1.67617 WP_000175965.1.67633 WP_000175965.1.67637 WP_000175965.1.67682 WP_000175965.1.67705 WP_000175965.1.67731 WP_000175965.1.67772 WP_000175965.1.67776 WP_000175965.1.67803 WP_000175965.1.67814 WP_000175965.1.6782 WP_000175965.1.67825 WP_000175965.1.67829 WP_000175965.1.6785 WP_000175965.1.67887 WP_000175965.1.67905 WP_000175965.1.67924 WP_000175965.1.67932 WP_000175965.1.67969 WP_000175965.1.67970 WP_000175965.1.67977 WP_000175965.1.67988 WP_000175965.1.68036 WP_000175965.1.68073 WP_000175965.1.68075 WP_000175965.1.6809 WP_000175965.1.68140 WP_000175965.1.68147 WP_000175965.1.68159 WP_000175965.1.68167 WP_000175965.1.68201 WP_000175965.1.68206 WP_000175965.1.68210 WP_000175965.1.6827 WP_000175965.1.68275 WP_000175965.1.6833 WP_000175965.1.68401 WP_000175965.1.68477 WP_000175965.1.68478 WP_000175965.1.6849 WP_000175965.1.685 WP_000175965.1.68532 WP_000175965.1.68547 WP_000175965.1.6857 WP_000175965.1.6858 WP_000175965.1.68589 WP_000175965.1.68591 WP_000175965.1.68629 WP_000175965.1.68652 WP_000175965.1.68655 WP_000175965.1.68656 WP_000175965.1.68658 WP_000175965.1.68677 WP_000175965.1.6869 WP_000175965.1.68690 WP_000175965.1.68778 WP_000175965.1.68787 WP_000175965.1.6879 WP_000175965.1.68816 WP_000175965.1.68818 WP_000175965.1.6882 WP_000175965.1.6883 WP_000175965.1.68893 WP_000175965.1.68894 WP_000175965.1.68895 WP_000175965.1.68928 WP_000175965.1.68958 WP_000175965.1.68966 WP_000175965.1.68975 WP_000175965.1.69001 WP_000175965.1.69006 WP_000175965.1.69011 WP_000175965.1.69029 WP_000175965.1.6904 WP_000175965.1.6905 WP_000175965.1.69058 WP_000175965.1.6907 WP_000175965.1.69080 WP_000175965.1.69086 WP_000175965.1.6913 WP_000175965.1.69131 WP_000175965.1.69139 WP_000175965.1.69146 WP_000175965.1.69151 WP_000175965.1.69236 WP_000175965.1.69255 WP_000175965.1.69273 WP_000175965.1.69288 WP_000175965.1.69296 WP_000175965.1.69320 WP_000175965.1.69346 WP_000175965.1.69357 WP_000175965.1.69359 WP_000175965.1.69385 WP_000175965.1.69397 WP_000175965.1.69433 WP_000175965.1.69485 WP_000175965.1.69515 WP_000175965.1.6954 WP_000175965.1.69554 WP_000175965.1.69564 WP_000175965.1.69575 WP_000175965.1.69588 WP_000175965.1.69592 WP_000175965.1.69616 WP_000175965.1.69636 WP_000175965.1.69644 WP_000175965.1.69704 WP_000175965.1.69710 WP_000175965.1.69758 WP_000175965.1.69760 WP_000175965.1.69767 WP_000175965.1.69785 WP_000175965.1.69787 WP_000175965.1.69807 WP_000175965.1.69808 WP_000175965.1.69817 WP_000175965.1.69839 WP_000175965.1.69890 WP_000175965.1.69965 WP_000175965.1.69975 WP_000175965.1.69977 WP_000175965.1.70003 WP_000175965.1.70028 WP_000175965.1.70047 WP_000175965.1.70087 WP_000175965.1.70088 WP_000175965.1.7010 WP_000175965.1.7014 WP_000175965.1.7016 WP_000175965.1.70169 WP_000175965.1.70183 WP_000175965.1.7021 WP_000175965.1.70241 WP_000175965.1.70248 WP_000175965.1.70269 WP_000175965.1.70272 WP_000175965.1.70281 WP_000175965.1.70289 WP_000175965.1.70290 WP_000175965.1.70303 WP_000175965.1.70321 WP_000175965.1.70326 WP_000175965.1.70327 WP_000175965.1.70355 WP_000175965.1.70394 WP_000175965.1.7044 WP_000175965.1.70440 WP_000175965.1.70447 WP_000175965.1.70485 WP_000175965.1.70491 WP_000175965.1.70523 WP_000175965.1.70531 WP_000175965.1.70547 WP_000175965.1.7055 WP_000175965.1.70596 WP_000175965.1.7060 WP_000175965.1.70643 WP_000175965.1.70662 WP_000175965.1.70678 WP_000175965.1.70683 WP_000175965.1.70685 WP_000175965.1.70712 WP_000175965.1.70732 WP_000175965.1.70733 WP_000175965.1.70761 WP_000175965.1.70785 WP_000175965.1.70792 WP_000175965.1.70837 WP_000175965.1.70869 WP_000175965.1.70883 WP_000175965.1.70899 WP_000175965.1.70914 WP_000175965.1.70922 WP_000175965.1.70929 WP_000175965.1.7093 WP_000175965.1.70948 WP_000175965.1.70959 WP_000175965.1.70969 WP_000175965.1.70977 WP_000175965.1.70985 WP_000175965.1.70986 WP_000175965.1.71007 WP_000175965.1.71010 WP_000175965.1.71023 WP_000175965.1.71069 WP_000175965.1.71088 WP_000175965.1.7110 WP_000175965.1.71116 WP_000175965.1.71120 WP_000175965.1.71146 WP_000175965.1.71150 WP_000175965.1.71165 WP_000175965.1.71171 WP_000175965.1.71172 WP_000175965.1.71184 WP_000175965.1.71188 WP_000175965.1.71201 WP_000175965.1.71202 WP_000175965.1.71243 WP_000175965.1.71245 WP_000175965.1.71248 WP_000175965.1.71305 WP_000175965.1.71306 WP_000175965.1.71337 WP_000175965.1.7134 WP_000175965.1.71363 WP_000175965.1.71368 WP_000175965.1.71378 WP_000175965.1.714 WP_000175965.1.71401 WP_000175965.1.71407 WP_000175965.1.71418 WP_000175965.1.7142 WP_000175965.1.71446 WP_000175965.1.71450 WP_000175965.1.71452 WP_000175965.1.71481 WP_000175965.1.71500 WP_000175965.1.71583 WP_000175965.1.71600 WP_000175965.1.71626 WP_000175965.1.71636 WP_000175965.1.71649 WP_000175965.1.71656 WP_000175965.1.71667 WP_000175965.1.71691 WP_000175965.1.71702 WP_000175965.1.7174 WP_000175965.1.71746 WP_000175965.1.71756 WP_000175965.1.71793 WP_000175965.1.71798 WP_000175965.1.71845 WP_000175965.1.71848 WP_000175965.1.71881 WP_000175965.1.71908 WP_000175965.1.71923 WP_000175965.1.71929 WP_000175965.1.71941 WP_000175965.1.71952 WP_000175965.1.71973 WP_000175965.1.71979 WP_000175965.1.71984 WP_000175965.1.720 WP_000175965.1.72065 WP_000175965.1.72068 WP_000175965.1.72100 WP_000175965.1.72105 WP_000175965.1.72107 WP_000175965.1.72119 WP_000175965.1.72121 WP_000175965.1.72182 WP_000175965.1.72190 WP_000175965.1.72203 WP_000175965.1.72220 WP_000175965.1.72221 WP_000175965.1.72226 WP_000175965.1.72234 WP_000175965.1.72243 WP_000175965.1.72254 WP_000175965.1.72277 WP_000175965.1.72281 WP_000175965.1.72283 WP_000175965.1.72300 WP_000175965.1.72307 WP_000175965.1.72325 WP_000175965.1.72339 WP_000175965.1.72351 WP_000175965.1.72372 WP_000175965.1.72376 WP_000175965.1.72382 WP_000175965.1.72403 WP_000175965.1.72412 WP_000175965.1.7243 WP_000175965.1.72438 WP_000175965.1.72470 WP_000175965.1.72532 WP_000175965.1.72594 WP_000175965.1.72602 WP_000175965.1.72625 WP_000175965.1.72629 WP_000175965.1.72642 WP_000175965.1.72671 WP_000175965.1.72689 WP_000175965.1.72716 WP_000175965.1.72718 WP_000175965.1.72728 WP_000175965.1.72793 WP_000175965.1.72797 WP_000175965.1.72827 WP_000175965.1.72843 WP_000175965.1.72850 WP_000175965.1.72865 WP_000175965.1.72871 WP_000175965.1.72887 WP_000175965.1.72894 WP_000175965.1.72897 WP_000175965.1.72946 WP_000175965.1.7295 WP_000175965.1.72968 WP_000175965.1.72975 WP_000175965.1.73062 WP_000175965.1.73068 WP_000175965.1.73102 WP_000175965.1.73125 WP_000175965.1.73144 WP_000175965.1.7315 WP_000175965.1.7316 WP_000175965.1.73164 WP_000175965.1.73200 WP_000175965.1.73328 WP_000175965.1.73338 WP_000175965.1.7334 WP_000175965.1.73362 WP_000175965.1.73377 WP_000175965.1.73379 WP_000175965.1.7341 WP_000175965.1.73461 WP_000175965.1.73481 WP_000175965.1.73512 WP_000175965.1.7356 WP_000175965.1.73561 WP_000175965.1.73581 WP_000175965.1.73596 WP_000175965.1.73617 WP_000175965.1.73667 WP_000175965.1.73669 WP_000175965.1.73701 WP_000175965.1.73708 WP_000175965.1.7374 WP_000175965.1.73753 WP_000175965.1.73758 WP_000175965.1.73764 WP_000175965.1.73794 WP_000175965.1.73804 WP_000175965.1.73831 WP_000175965.1.73847 WP_000175965.1.7387 WP_000175965.1.73901 WP_000175965.1.73924 WP_000175965.1.73926 WP_000175965.1.7394 WP_000175965.1.73945 WP_000175965.1.73956 WP_000175965.1.73958 WP_000175965.1.73965 WP_000175965.1.74028 WP_000175965.1.74029 WP_000175965.1.74040 WP_000175965.1.74049 WP_000175965.1.7405 WP_000175965.1.74089 WP_000175965.1.74117 WP_000175965.1.74163 WP_000175965.1.74174 WP_000175965.1.74181 WP_000175965.1.74191 WP_000175965.1.74207 WP_000175965.1.74228 WP_000175965.1.74248 WP_000175965.1.743 WP_000175965.1.74300 WP_000175965.1.7433 WP_000175965.1.74379 WP_000175965.1.74402 WP_000175965.1.74410 WP_000175965.1.74414 WP_000175965.1.74422 WP_000175965.1.74428 WP_000175965.1.7444 WP_000175965.1.74454 WP_000175965.1.74466 WP_000175965.1.74469 WP_000175965.1.74481 WP_000175965.1.745 WP_000175965.1.74500 WP_000175965.1.74529 WP_000175965.1.74545 WP_000175965.1.74570 WP_000175965.1.74578 WP_000175965.1.7458 WP_000175965.1.74620 WP_000175965.1.74632 WP_000175965.1.74639 WP_000175965.1.74661 WP_000175965.1.74741 WP_000175965.1.74745 WP_000175965.1.74757 WP_000175965.1.74806 WP_000175965.1.74807 WP_000175965.1.74826 WP_000175965.1.74876 WP_000175965.1.74884 WP_000175965.1.7491 WP_000175965.1.74946 WP_000175965.1.74972 WP_000175965.1.74992 WP_000175965.1.74996 WP_000175965.1.75009 WP_000175965.1.75051 WP_000175965.1.75056 WP_000175965.1.75058 WP_000175965.1.75114 WP_000175965.1.75129 WP_000175965.1.75134 WP_000175965.1.75148 WP_000175965.1.75159 WP_000175965.1.75180 WP_000175965.1.75187 WP_000175965.1.75288 WP_000175965.1.75301 WP_000175965.1.7531 WP_000175965.1.75334 WP_000175965.1.75362 WP_000175965.1.75371 WP_000175965.1.75385 WP_000175965.1.75392 WP_000175965.1.75400 WP_000175965.1.75402 WP_000175965.1.75450 WP_000175965.1.7558 WP_000175965.1.75607 WP_000175965.1.75609 WP_000175965.1.7563 WP_000175965.1.75703 WP_000175965.1.75716 WP_000175965.1.75740 WP_000175965.1.75751 WP_000175965.1.75760 WP_000175965.1.75764 WP_000175965.1.75793 WP_000175965.1.75794 WP_000175965.1.75810 WP_000175965.1.75828 WP_000175965.1.75835 WP_000175965.1.75837 WP_000175965.1.75863 WP_000175965.1.75873 WP_000175965.1.75874 WP_000175965.1.75884 WP_000175965.1.75902 WP_000175965.1.75932 WP_000175965.1.75945 WP_000175965.1.75957 WP_000175965.1.76 WP_000175965.1.76020 WP_000175965.1.76024 WP_000175965.1.76097 WP_000175965.1.76102 WP_000175965.1.76108 WP_000175965.1.76115 WP_000175965.1.76137 WP_000175965.1.76156 WP_000175965.1.76162 WP_000175965.1.76164 WP_000175965.1.76170 WP_000175965.1.76197 WP_000175965.1.76208 WP_000175965.1.76252 WP_000175965.1.76301 WP_000175965.1.76327 WP_000175965.1.76345 WP_000175965.1.76346 WP_000175965.1.76364 WP_000175965.1.76434 WP_000175965.1.76445 WP_000175965.1.76451 WP_000175965.1.76471 WP_000175965.1.76495 WP_000175965.1.76529 WP_000175965.1.76532 WP_000175965.1.76548 WP_000175965.1.7655 WP_000175965.1.7657 WP_000175965.1.76576 WP_000175965.1.7660 WP_000175965.1.76611 WP_000175965.1.76673 WP_000175965.1.76706 WP_000175965.1.7672 WP_000175965.1.76721 WP_000175965.1.76724 WP_000175965.1.76756 WP_000175965.1.76760 WP_000175965.1.76776 WP_000175965.1.76799 WP_000175965.1.76806 WP_000175965.1.7684 WP_000175965.1.76866 WP_000175965.1.76875 WP_000175965.1.76880 WP_000175965.1.76899 WP_000175965.1.76913 WP_000175965.1.76968 WP_000175965.1.77017 WP_000175965.1.77033 WP_000175965.1.77038 WP_000175965.1.77047 WP_000175965.1.77067 WP_000175965.1.77080 WP_000175965.1.7712 WP_000175965.1.77177 WP_000175965.1.77180 WP_000175965.1.77184 WP_000175965.1.77193 WP_000175965.1.77241 WP_000175965.1.77244 WP_000175965.1.77267 WP_000175965.1.77271 WP_000175965.1.77292 WP_000175965.1.77306 WP_000175965.1.77349 WP_000175965.1.77356 WP_000175965.1.77390 WP_000175965.1.77431 WP_000175965.1.77436 WP_000175965.1.77440 WP_000175965.1.77475 WP_000175965.1.77496 WP_000175965.1.77514 WP_000175965.1.77529 WP_000175965.1.77543 WP_000175965.1.77549 WP_000175965.1.77565 WP_000175965.1.77575 WP_000175965.1.77596 WP_000175965.1.77622 WP_000175965.1.77629 WP_000175965.1.77653 WP_000175965.1.77692 WP_000175965.1.77710 WP_000175965.1.77754 WP_000175965.1.77761 WP_000175965.1.7782 WP_000175965.1.7784 WP_000175965.1.77851 WP_000175965.1.77871 WP_000175965.1.77898 WP_000175965.1.77918 WP_000175965.1.7792 WP_000175965.1.7793 WP_000175965.1.77951 WP_000175965.1.77960 WP_000175965.1.77983 WP_000175965.1.77987 WP_000175965.1.77989 WP_000175965.1.78 WP_000175965.1.78016 WP_000175965.1.7802 WP_000175965.1.78026 WP_000175965.1.78033 WP_000175965.1.78051 WP_000175965.1.78053 WP_000175965.1.78076 WP_000175965.1.78096 WP_000175965.1.78100 WP_000175965.1.78110 WP_000175965.1.78120 WP_000175965.1.7814 WP_000175965.1.78168 WP_000175965.1.78170 WP_000175965.1.78180 WP_000175965.1.78201 WP_000175965.1.78245 WP_000175965.1.78259 WP_000175965.1.78301 WP_000175965.1.78339 WP_000175965.1.78352 WP_000175965.1.78366 WP_000175965.1.78372 WP_000175965.1.78383 WP_000175965.1.78407 WP_000175965.1.78443 WP_000175965.1.78495 WP_000175965.1.78496 WP_000175965.1.78501 WP_000175965.1.78502 WP_000175965.1.78602 WP_000175965.1.78603 WP_000175965.1.7861 WP_000175965.1.78618 WP_000175965.1.78632 WP_000175965.1.78658 WP_000175965.1.78673 WP_000175965.1.78697 WP_000175965.1.78715 WP_000175965.1.78734 WP_000175965.1.78735 WP_000175965.1.78738 WP_000175965.1.7877 WP_000175965.1.78771 WP_000175965.1.78789 WP_000175965.1.78802 WP_000175965.1.78815 WP_000175965.1.78830 WP_000175965.1.78835 WP_000175965.1.78838 WP_000175965.1.78862 WP_000175965.1.78871 WP_000175965.1.78874 WP_000175965.1.78877 WP_000175965.1.78881 WP_000175965.1.78896 WP_000175965.1.7891 WP_000175965.1.78913 WP_000175965.1.78918 WP_000175965.1.7893 WP_000175965.1.78930 WP_000175965.1.78951 WP_000175965.1.78959 WP_000175965.1.79011 WP_000175965.1.79032 WP_000175965.1.79081 WP_000175965.1.79140 WP_000175965.1.79151 WP_000175965.1.79167 WP_000175965.1.79189 WP_000175965.1.79203 WP_000175965.1.79289 WP_000175965.1.79302 WP_000175965.1.79335 WP_000175965.1.79370 WP_000175965.1.794 WP_000175965.1.79427 WP_000175965.1.79462 WP_000175965.1.79466 WP_000175965.1.79468 WP_000175965.1.79472 WP_000175965.1.79490 WP_000175965.1.79495 WP_000175965.1.79529 WP_000175965.1.79531 WP_000175965.1.7956 WP_000175965.1.79570 WP_000175965.1.79580 WP_000175965.1.79586 WP_000175965.1.79635 WP_000175965.1.7964 WP_000175965.1.79642 WP_000175965.1.79659 WP_000175965.1.79668 WP_000175965.1.79708 WP_000175965.1.79734 WP_000175965.1.79757 WP_000175965.1.79778 WP_000175965.1.7979 WP_000175965.1.7982 WP_000175965.1.79832 WP_000175965.1.79842 WP_000175965.1.79845 WP_000175965.1.79867 WP_000175965.1.79892 WP_000175965.1.7991 WP_000175965.1.79914 WP_000175965.1.79929 WP_000175965.1.79934 WP_000175965.1.7994 WP_000175965.1.79942 WP_000175965.1.79945 WP_000175965.1.79951 WP_000175965.1.79966 WP_000175965.1.79974 WP_000175965.1.79977 WP_000175965.1.79996 WP_000175965.1.80077 WP_000175965.1.80137 WP_000175965.1.80149 WP_000175965.1.80157 WP_000175965.1.80182 WP_000175965.1.80229 WP_000175965.1.80236 WP_000175965.1.8024 WP_000175965.1.80249 WP_000175965.1.80254 WP_000175965.1.80293 WP_000175965.1.80296 WP_000175965.1.80307 WP_000175965.1.80333 WP_000175965.1.80366 WP_000175965.1.80380 WP_000175965.1.80443 WP_000175965.1.80448 WP_000175965.1.80473 WP_000175965.1.80479 WP_000175965.1.80496 WP_000175965.1.80529 WP_000175965.1.80542 WP_000175965.1.80586 WP_000175965.1.80609 WP_000175965.1.80629 WP_000175965.1.80638 WP_000175965.1.80651 WP_000175965.1.80667 WP_000175965.1.80674 WP_000175965.1.80705 WP_000175965.1.80707 WP_000175965.1.80725 WP_000175965.1.80741 WP_000175965.1.80750 WP_000175965.1.80757 WP_000175965.1.80760 WP_000175965.1.80780 WP_000175965.1.80803 WP_000175965.1.80819 WP_000175965.1.80827 WP_000175965.1.80831 WP_000175965.1.80840 WP_000175965.1.80850 WP_000175965.1.80857 WP_000175965.1.80868 WP_000175965.1.80874 WP_000175965.1.80876 WP_000175965.1.80881 WP_000175965.1.80927 WP_000175965.1.80939 WP_000175965.1.80941 WP_000175965.1.8096 WP_000175965.1.81037 WP_000175965.1.81041 WP_000175965.1.8106 WP_000175965.1.81062 WP_000175965.1.81067 WP_000175965.1.81069 WP_000175965.1.81084 WP_000175965.1.81107 WP_000175965.1.81109 WP_000175965.1.81110 WP_000175965.1.81118 WP_000175965.1.81149 WP_000175965.1.81175 WP_000175965.1.8119 WP_000175965.1.81193 WP_000175965.1.81197 WP_000175965.1.81225 WP_000175965.1.81231 WP_000175965.1.81275 WP_000175965.1.8130 WP_000175965.1.81302 WP_000175965.1.81305 WP_000175965.1.81320 WP_000175965.1.81321 WP_000175965.1.81328 WP_000175965.1.8134 WP_000175965.1.81354 WP_000175965.1.81388 WP_000175965.1.81404 WP_000175965.1.81409 WP_000175965.1.81410 WP_000175965.1.81425 WP_000175965.1.81455 WP_000175965.1.81504 WP_000175965.1.81528 WP_000175965.1.81548 WP_000175965.1.81568 WP_000175965.1.81667 WP_000175965.1.81668 WP_000175965.1.8168 WP_000175965.1.81727 WP_000175965.1.81735 WP_000175965.1.81736 WP_000175965.1.81743 WP_000175965.1.81746 WP_000175965.1.81750 WP_000175965.1.81760 WP_000175965.1.81768 WP_000175965.1.81785 WP_000175965.1.81795 WP_000175965.1.81798 WP_000175965.1.81902 WP_000175965.1.81941 WP_000175965.1.8196 WP_000175965.1.81965 WP_000175965.1.81974 WP_000175965.1.81995 WP_000175965.1.82037 WP_000175965.1.82099 WP_000175965.1.82132 WP_000175965.1.82141 WP_000175965.1.82144 WP_000175965.1.82149 WP_000175965.1.82192 WP_000175965.1.82232 WP_000175965.1.82258 WP_000175965.1.82269 WP_000175965.1.82337 WP_000175965.1.82347 WP_000175965.1.82352 WP_000175965.1.8236 WP_000175965.1.82369 WP_000175965.1.82395 WP_000175965.1.82401 WP_000175965.1.82420 WP_000175965.1.82434 WP_000175965.1.82464 WP_000175965.1.8247 WP_000175965.1.82474 WP_000175965.1.82479 WP_000175965.1.82503 WP_000175965.1.82515 WP_000175965.1.82562 WP_000175965.1.82569 WP_000175965.1.82570 WP_000175965.1.82636 WP_000175965.1.82637 WP_000175965.1.82648 WP_000175965.1.82676 WP_000175965.1.82692 WP_000175965.1.82761 WP_000175965.1.8282 WP_000175965.1.82841 WP_000175965.1.82843 WP_000175965.1.82865 WP_000175965.1.82886 WP_000175965.1.82895 WP_000175965.1.82899 WP_000175965.1.82908 WP_000175965.1.82937 WP_000175965.1.82944 WP_000175965.1.82946 WP_000175965.1.82956 WP_000175965.1.82964 WP_000175965.1.82992 WP_000175965.1.83005 WP_000175965.1.83006 WP_000175965.1.83061 WP_000175965.1.83092 WP_000175965.1.83119 WP_000175965.1.83163 WP_000175965.1.83204 WP_000175965.1.8322 WP_000175965.1.83221 WP_000175965.1.83247 WP_000175965.1.83252 WP_000175965.1.83258 WP_000175965.1.83280 WP_000175965.1.83301 WP_000175965.1.83305 WP_000175965.1.83331 WP_000175965.1.83354 WP_000175965.1.83356 WP_000175965.1.83365 WP_000175965.1.83378 WP_000175965.1.83382 WP_000175965.1.83388 WP_000175965.1.83407 WP_000175965.1.83413 WP_000175965.1.83491 WP_000175965.1.83516 WP_000175965.1.83523 WP_000175965.1.8354 WP_000175965.1.83558 WP_000175965.1.83572 WP_000175965.1.83650 WP_000175965.1.83651 WP_000175965.1.83710 WP_000175965.1.83721 WP_000175965.1.83739 WP_000175965.1.83759 WP_000175965.1.83760 WP_000175965.1.83806 WP_000175965.1.83854 WP_000175965.1.83897 WP_000175965.1.83960 WP_000175965.1.83979 WP_000175965.1.8399 WP_000175965.1.83995 WP_000175965.1.84000 WP_000175965.1.84001 WP_000175965.1.84011 WP_000175965.1.84075 WP_000175965.1.84077 WP_000175965.1.84083 WP_000175965.1.84086 WP_000175965.1.84100 WP_000175965.1.84103 WP_000175965.1.84106 WP_000175965.1.84115 WP_000175965.1.84154 WP_000175965.1.84168 WP_000175965.1.84198 WP_000175965.1.84205 WP_000175965.1.84209 WP_000175965.1.84229 WP_000175965.1.8425 WP_000175965.1.84283 WP_000175965.1.84291 WP_000175965.1.84300 WP_000175965.1.84325 WP_000175965.1.84355 WP_000175965.1.84373 WP_000175965.1.84392 WP_000175965.1.84397 WP_000175965.1.84403 WP_000175965.1.8441 WP_000175965.1.84459 WP_000175965.1.84461 WP_000175965.1.84497 WP_000175965.1.84515 WP_000175965.1.84523 WP_000175965.1.84532 WP_000175965.1.84551 WP_000175965.1.84554 WP_000175965.1.84572 WP_000175965.1.84598 WP_000175965.1.84644 WP_000175965.1.84659 WP_000175965.1.84683 WP_000175965.1.84693 WP_000175965.1.84711 WP_000175965.1.84721 WP_000175965.1.84745 WP_000175965.1.84814 WP_000175965.1.84860 WP_000175965.1.84872 WP_000175965.1.84876 WP_000175965.1.84879 WP_000175965.1.84885 WP_000175965.1.84899 WP_000175965.1.849 WP_000175965.1.8497 WP_000175965.1.84983 WP_000175965.1.850 WP_000175965.1.85014 WP_000175965.1.85031 WP_000175965.1.85040 WP_000175965.1.85079 WP_000175965.1.85094 WP_000175965.1.85120 WP_000175965.1.85126 WP_000175965.1.85134 WP_000175965.1.85147 WP_000175965.1.85178 WP_000175965.1.85180 WP_000175965.1.85190 WP_000175965.1.85192 WP_000175965.1.85217 WP_000175965.1.8526 WP_000175965.1.85271 WP_000175965.1.85301 WP_000175965.1.8533 WP_000175965.1.8537 WP_000175965.1.85408 WP_000175965.1.85433 WP_000175965.1.8545 WP_000175965.1.85456 WP_000175965.1.85481 WP_000175965.1.85483 WP_000175965.1.8552 WP_000175965.1.85541 WP_000175965.1.8556 WP_000175965.1.85568 WP_000175965.1.85615 WP_000175965.1.85617 WP_000175965.1.85654 WP_000175965.1.85663 WP_000175965.1.85671 WP_000175965.1.85672 WP_000175965.1.85675 WP_000175965.1.85723 WP_000175965.1.85742 WP_000175965.1.85759 WP_000175965.1.85777 WP_000175965.1.85780 WP_000175965.1.85784 WP_000175965.1.85797 WP_000175965.1.85854 WP_000175965.1.85855 WP_000175965.1.85864 WP_000175965.1.85886 WP_000175965.1.85900 WP_000175965.1.85904 WP_000175965.1.85943 WP_000175965.1.85976 WP_000175965.1.85982 WP_000175965.1.86007 WP_000175965.1.86010 WP_000175965.1.86017 WP_000175965.1.86043 WP_000175965.1.86092 WP_000175965.1.86120 WP_000175965.1.86126 WP_000175965.1.86138 WP_000175965.1.86157 WP_000175965.1.86159 WP_000175965.1.8616 WP_000175965.1.86173 WP_000175965.1.86206 WP_000175965.1.86224 WP_000175965.1.86240 WP_000175965.1.86259 WP_000175965.1.86284 WP_000175965.1.86285 WP_000175965.1.86306 WP_000175965.1.86316 WP_000175965.1.86335 WP_000175965.1.86347 WP_000175965.1.86356 WP_000175965.1.86380 WP_000175965.1.86389 WP_000175965.1.86442 WP_000175965.1.86450 WP_000175965.1.86453 WP_000175965.1.86466 WP_000175965.1.86469 WP_000175965.1.8647 WP_000175965.1.86514 WP_000175965.1.86580 WP_000175965.1.86588 WP_000175965.1.86593 WP_000175965.1.86610 WP_000175965.1.86634 WP_000175965.1.86656 WP_000175965.1.86658 WP_000175965.1.86661 WP_000175965.1.86699 WP_000175965.1.8671 WP_000175965.1.8672 WP_000175965.1.86744 WP_000175965.1.8678 WP_000175965.1.86807 WP_000175965.1.86810 WP_000175965.1.8684 WP_000175965.1.86860 WP_000175965.1.86895 WP_000175965.1.86902 WP_000175965.1.86906 WP_000175965.1.8691 WP_000175965.1.86915 WP_000175965.1.86921 WP_000175965.1.86982 WP_000175965.1.87038 WP_000175965.1.87051 WP_000175965.1.87095 WP_000175965.1.87143 WP_000175965.1.87187 WP_000175965.1.87219 WP_000175965.1.8722 WP_000175965.1.87220 WP_000175965.1.87265 WP_000175965.1.87276 WP_000175965.1.87282 WP_000175965.1.87283 WP_000175965.1.8736 WP_000175965.1.87365 WP_000175965.1.87376 WP_000175965.1.87460 WP_000175965.1.87484 WP_000175965.1.87493 WP_000175965.1.87500 WP_000175965.1.87552 WP_000175965.1.87583 WP_000175965.1.87584 WP_000175965.1.87618 WP_000175965.1.87626 WP_000175965.1.87651 WP_000175965.1.8767 WP_000175965.1.87687 WP_000175965.1.87695 WP_000175965.1.87712 WP_000175965.1.87760 WP_000175965.1.87779 WP_000175965.1.87813 WP_000175965.1.87875 WP_000175965.1.87891 WP_000175965.1.87899 WP_000175965.1.87905 WP_000175965.1.8792 WP_000175965.1.87936 WP_000175965.1.87945 WP_000175965.1.87999 WP_000175965.1.8800 WP_000175965.1.88019 WP_000175965.1.88052 WP_000175965.1.88073 WP_000175965.1.8809 WP_000175965.1.88092 WP_000175965.1.88136 WP_000175965.1.88174 WP_000175965.1.88185 WP_000175965.1.88214 WP_000175965.1.88222 WP_000175965.1.88264 WP_000175965.1.88275 WP_000175965.1.88291 WP_000175965.1.88293 WP_000175965.1.88303 WP_000175965.1.88356 WP_000175965.1.8837 WP_000175965.1.88393 WP_000175965.1.88423 WP_000175965.1.88474 WP_000175965.1.88483 WP_000175965.1.8849 WP_000175965.1.88508 WP_000175965.1.88597 WP_000175965.1.88620 WP_000175965.1.88624 WP_000175965.1.88675 WP_000175965.1.88683 WP_000175965.1.88698 WP_000175965.1.88703 WP_000175965.1.88731 WP_000175965.1.88776 WP_000175965.1.88792 WP_000175965.1.88817 WP_000175965.1.88845 WP_000175965.1.88854 WP_000175965.1.88902 WP_000175965.1.8891 WP_000175965.1.88942 WP_000175965.1.88957 WP_000175965.1.88966 WP_000175965.1.88967 WP_000175965.1.88968 WP_000175965.1.88970 WP_000175965.1.88980 WP_000175965.1.88982 WP_000175965.1.88995 WP_000175965.1.88998 WP_000175965.1.89008 WP_000175965.1.89054 WP_000175965.1.89114 WP_000175965.1.89116 WP_000175965.1.89119 WP_000175965.1.89120 WP_000175965.1.89138 WP_000175965.1.89174 WP_000175965.1.89177 WP_000175965.1.89188 WP_000175965.1.89215 WP_000175965.1.89221 WP_000175965.1.89304 WP_000175965.1.89355 WP_000175965.1.89362 WP_000175965.1.89408 WP_000175965.1.89425 WP_000175965.1.89452 WP_000175965.1.89462 WP_000175965.1.89512 WP_000175965.1.89527 WP_000175965.1.89570 WP_000175965.1.89580 WP_000175965.1.89604 WP_000175965.1.89606 WP_000175965.1.8961 WP_000175965.1.89622 WP_000175965.1.89632 WP_000175965.1.89634 WP_000175965.1.89636 WP_000175965.1.89647 WP_000175965.1.89657 WP_000175965.1.89659 WP_000175965.1.89680 WP_000175965.1.89746 WP_000175965.1.89764 WP_000175965.1.89765 WP_000175965.1.89777 WP_000175965.1.89789 WP_000175965.1.89815 WP_000175965.1.89817 WP_000175965.1.89832 WP_000175965.1.89854 WP_000175965.1.89870 WP_000175965.1.89902 WP_000175965.1.89914 WP_000175965.1.89940 WP_000175965.1.8996 WP_000175965.1.89965 WP_000175965.1.9003 WP_000175965.1.90033 WP_000175965.1.90084 WP_000175965.1.90097 WP_000175965.1.90193 WP_000175965.1.90211 WP_000175965.1.90220 WP_000175965.1.90252 WP_000175965.1.90293 WP_000175965.1.90311 WP_000175965.1.90348 WP_000175965.1.90417 WP_000175965.1.90421 WP_000175965.1.90440 WP_000175965.1.90453 WP_000175965.1.90458 WP_000175965.1.90521 WP_000175965.1.90522 WP_000175965.1.90540 WP_000175965.1.90557 WP_000175965.1.90563 WP_000175965.1.90585 WP_000175965.1.90625 WP_000175965.1.9064 WP_000175965.1.90641 WP_000175965.1.90701 WP_000175965.1.90734 WP_000175965.1.90748 WP_000175965.1.90759 WP_000175965.1.90792 WP_000175965.1.90814 WP_000175965.1.90859 WP_000175965.1.90876 WP_000175965.1.90878 WP_000175965.1.9089 WP_000175965.1.9093 WP_000175965.1.90959 WP_000175965.1.90973 WP_000175965.1.90984 WP_000175965.1.90991 WP_000175965.1.91003 WP_000175965.1.91023 WP_000175965.1.91042 WP_000175965.1.91049 WP_000175965.1.91056 WP_000175965.1.91069 WP_000175965.1.91107 WP_000175965.1.91156 WP_000175965.1.91179 WP_000175965.1.91189 WP_000175965.1.91215 WP_000175965.1.91278 WP_000175965.1.91282 WP_000175965.1.9131 WP_000175965.1.91312 WP_000175965.1.91331 WP_000175965.1.91334 WP_000175965.1.9137 WP_000175965.1.91372 WP_000175965.1.91381 WP_000175965.1.91405 WP_000175965.1.91424 WP_000175965.1.91453 WP_000175965.1.91459 WP_000175965.1.91470 WP_000175965.1.91473 WP_000175965.1.91474 WP_000175965.1.91493 WP_000175965.1.91505 WP_000175965.1.91512 WP_000175965.1.91524 WP_000175965.1.91564 WP_000175965.1.91579 WP_000175965.1.91621 WP_000175965.1.91625 WP_000175965.1.91628 WP_000175965.1.91655 WP_000175965.1.9166 WP_000175965.1.91702 WP_000175965.1.91724 WP_000175965.1.91732 WP_000175965.1.91736 WP_000175965.1.91742 WP_000175965.1.91772 WP_000175965.1.91776 WP_000175965.1.91788 WP_000175965.1.91795 WP_000175965.1.91864 WP_000175965.1.91880 WP_000175965.1.91898 WP_000175965.1.91903 WP_000175965.1.91904 WP_000175965.1.91914 WP_000175965.1.91974 WP_000175965.1.91984 WP_000175965.1.92013 WP_000175965.1.92039 WP_000175965.1.92044 WP_000175965.1.92047 WP_000175965.1.92060 WP_000175965.1.92067 WP_000175965.1.92068 WP_000175965.1.92082 WP_000175965.1.92093 WP_000175965.1.92099 WP_000175965.1.92108 WP_000175965.1.92122 WP_000175965.1.92129 WP_000175965.1.92149 WP_000175965.1.92165 WP_000175965.1.92171 WP_000175965.1.92183 WP_000175965.1.92208 WP_000175965.1.92213 WP_000175965.1.9222 WP_000175965.1.92268 WP_000175965.1.92270 WP_000175965.1.92310 WP_000175965.1.92318 WP_000175965.1.92375 WP_000175965.1.92394 WP_000175965.1.92396 WP_000175965.1.92408 WP_000175965.1.92411 WP_000175965.1.92439 WP_000175965.1.92443 WP_000175965.1.92452 WP_000175965.1.92482 WP_000175965.1.92529 WP_000175965.1.9253 WP_000175965.1.92531 WP_000175965.1.92557 WP_000175965.1.92575 WP_000175965.1.92628 WP_000175965.1.92646 WP_000175965.1.92659 WP_000175965.1.92669 WP_000175965.1.92671 WP_000175965.1.92729 WP_000175965.1.92738 WP_000175965.1.92754 WP_000175965.1.92758 WP_000175965.1.92786 WP_000175965.1.92806 WP_000175965.1.92827 WP_000175965.1.92832 WP_000175965.1.92836 WP_000175965.1.92842 WP_000175965.1.92843 WP_000175965.1.92879 WP_000175965.1.92883 WP_000175965.1.92890 WP_000175965.1.92893 WP_000175965.1.92895 WP_000175965.1.92926 WP_000175965.1.92929 WP_000175965.1.92936 WP_000175965.1.92939 WP_000175965.1.92947 WP_000175965.1.92975 WP_000175965.1.92988 WP_000175965.1.93059 WP_000175965.1.93061 WP_000175965.1.93076 WP_000175965.1.93086 WP_000175965.1.93101 WP_000175965.1.93118 WP_000175965.1.93136 WP_000175965.1.93155 WP_000175965.1.93215 WP_000175965.1.93275 WP_000175965.1.93339 WP_000175965.1.93350 WP_000175965.1.93365 WP_000175965.1.93376 WP_000175965.1.93410 WP_000175965.1.93524 WP_000175965.1.93543 WP_000175965.1.93577 WP_000175965.1.93596 WP_000175965.1.93604 WP_000175965.1.93650 WP_000175965.1.93656 WP_000175965.1.93662 WP_000175965.1.93671 WP_000175965.1.93691 WP_000175965.1.937 WP_000175965.1.93705 WP_000175965.1.93741 WP_000175965.1.93761 WP_000175965.1.93767 WP_000175965.1.9380 WP_000175965.1.93803 WP_000175965.1.93804 WP_000175965.1.93809 WP_000175965.1.93837 WP_000175965.1.9389 WP_000175965.1.93937 WP_000175965.1.9394 WP_000175965.1.93956 WP_000175965.1.93986 WP_000175965.1.93994 WP_000175965.1.94039 WP_000175965.1.94056 WP_000175965.1.94070 WP_000175965.1.94071 WP_000175965.1.94072 WP_000175965.1.94162 WP_000175965.1.94167 WP_000175965.1.94168 WP_000175965.1.94181 WP_000175965.1.94198 WP_000175965.1.9432 WP_000175965.1.94352 WP_000175965.1.94354 WP_000175965.1.94379 WP_000175965.1.94380 WP_000175965.1.94383 WP_000175965.1.9440 WP_000175965.1.94412 WP_000175965.1.94458 WP_000175965.1.94473 WP_000175965.1.94557 WP_000175965.1.94562 WP_000175965.1.94565 WP_000175965.1.94584 WP_000175965.1.94588 WP_000175965.1.94598 WP_000175965.1.94622 WP_000175965.1.9463 WP_000175965.1.94649 WP_000175965.1.94655 WP_000175965.1.94669 WP_000175965.1.94670 WP_000175965.1.94674 WP_000175965.1.94717 WP_000175965.1.94722 WP_000175965.1.94785 WP_000175965.1.94796 WP_000175965.1.94798 WP_000175965.1.9481 WP_000175965.1.94817 WP_000175965.1.94835 WP_000175965.1.94862 WP_000175965.1.94959 WP_000175965.1.94967 WP_000175965.1.94971 WP_000175965.1.94982 WP_000175965.1.94983 WP_000175965.1.94986 WP_000175965.1.94987 WP_000175965.1.9503 WP_000175965.1.95051 WP_000175965.1.95085 WP_000175965.1.95094 WP_000175965.1.95121 WP_000175965.1.95133 WP_000175965.1.95136 WP_000175965.1.95152 WP_000175965.1.9516 WP_000175965.1.95235 WP_000175965.1.95248 WP_000175965.1.95249 WP_000175965.1.9527 WP_000175965.1.95277 WP_000175965.1.95282 WP_000175965.1.95289 WP_000175965.1.95298 WP_000175965.1.9530 WP_000175965.1.95388 WP_000175965.1.95404 WP_000175965.1.95434 WP_000175965.1.95447 WP_000175965.1.95456 WP_000175965.1.95465 WP_000175965.1.95558 WP_000175965.1.95579 WP_000175965.1.95607 WP_000175965.1.95623 WP_000175965.1.95630 WP_000175965.1.95656 WP_000175965.1.95670 WP_000175965.1.95691 WP_000175965.1.95701 WP_000175965.1.95703 WP_000175965.1.95729 WP_000175965.1.9574 WP_000175965.1.95744 WP_000175965.1.95757 WP_000175965.1.95803 WP_000175965.1.95805 WP_000175965.1.95826 WP_000175965.1.95840 WP_000175965.1.9586 WP_000175965.1.95866 WP_000175965.1.95901 WP_000175965.1.95911 WP_000175965.1.95939 WP_000175965.1.95963 WP_000175965.1.96004 WP_000175965.1.96042 WP_000175965.1.9609 WP_000175965.1.96107 WP_000175965.1.96139 WP_000175965.1.96141 WP_000175965.1.96162 WP_000175965.1.96172 WP_000175965.1.96190 WP_000175965.1.96203 WP_000175965.1.96206 WP_000175965.1.9624 WP_000175965.1.96260 WP_000175965.1.9627 WP_000175965.1.96317 WP_000175965.1.96335 WP_000175965.1.96340 WP_000175965.1.96343 WP_000175965.1.96348 WP_000175965.1.96349 WP_000175965.1.96380 WP_000175965.1.96404 WP_000175965.1.96429 WP_000175965.1.9644 WP_000175965.1.96469 WP_000175965.1.96490 WP_000175965.1.96497 WP_000175965.1.96500 WP_000175965.1.96521 WP_000175965.1.96537 WP_000175965.1.96555 WP_000175965.1.96563 WP_000175965.1.96584 WP_000175965.1.96588 WP_000175965.1.96590 WP_000175965.1.96600 WP_000175965.1.96640 WP_000175965.1.96642 WP_000175965.1.96662 WP_000175965.1.96721 WP_000175965.1.96731 WP_000175965.1.96732 WP_000175965.1.96735 WP_000175965.1.9674 WP_000175965.1.96758 WP_000175965.1.96761 WP_000175965.1.96771 WP_000175965.1.96798 WP_000175965.1.9686 WP_000175965.1.96876 WP_000175965.1.96890 WP_000175965.1.96902 WP_000175965.1.96917 WP_000175965.1.96993 WP_000175965.1.97005 WP_000175965.1.97015 WP_000175965.1.97043 WP_000175965.1.97047 WP_000175965.1.97089 WP_000175965.1.97103 WP_000175965.1.97143 WP_000175965.1.97145 WP_000175965.1.97185 WP_000175965.1.97190 WP_000175965.1.97224 WP_000175965.1.97297 WP_000175965.1.97318 WP_000175965.1.97322 WP_000175965.1.97328 WP_000175965.1.97369 WP_000175965.1.97386 WP_000175965.1.97413 WP_000175965.1.97477 WP_000175965.1.97480 WP_000175965.1.97487 WP_000175965.1.97496 WP_000175965.1.97547 WP_000175965.1.97594 WP_000175965.1.97597 WP_000175965.1.97613 WP_000175965.1.97620 WP_000175965.1.97628 WP_000175965.1.97631 WP_000175965.1.97640 WP_000175965.1.97648 WP_000175965.1.97656 WP_000175965.1.97693 WP_000175965.1.97704 WP_000175965.1.97726 WP_000175965.1.97727 WP_000175965.1.97732 WP_000175965.1.97736 WP_000175965.1.9774 WP_000175965.1.9775 WP_000175965.1.97768 WP_000175965.1.97800 WP_000175965.1.97846 WP_000175965.1.97873 WP_000175965.1.97907 WP_000175965.1.9793 WP_000175965.1.97981 WP_000175965.1.97983 WP_000175965.1.9799 WP_000175965.1.97991 WP_000175965.1.98006 WP_000175965.1.98019 WP_000175965.1.98022 WP_000175965.1.98107 WP_000175965.1.98110 WP_000175965.1.98119 WP_000175965.1.98124 WP_000175965.1.98146 WP_000175965.1.98170 WP_000175965.1.98201 WP_000175965.1.98219 WP_000175965.1.98236 WP_000175965.1.98250 WP_000175965.1.9826 WP_000175965.1.98338 WP_000175965.1.98392 WP_000175965.1.98402 WP_000175965.1.98403 WP_000175965.1.9841 WP_000175965.1.98438 WP_000175965.1.98440 WP_000175965.1.98446 WP_000175965.1.98472 WP_000175965.1.98483 WP_000175965.1.98495 WP_000175965.1.98513 WP_000175965.1.98531 WP_000175965.1.98551 WP_000175965.1.98570 WP_000175965.1.98577 WP_000175965.1.98608 WP_000175965.1.98627 WP_000175965.1.9863 WP_000175965.1.98634 WP_000175965.1.98676 WP_000175965.1.98677 WP_000175965.1.98726 WP_000175965.1.98751 WP_000175965.1.98760 WP_000175965.1.98763 WP_000175965.1.98779 WP_000175965.1.98843 WP_000175965.1.9887 WP_000175965.1.98899 WP_000175965.1.98931 WP_000175965.1.98947 WP_000175965.1.9898 WP_000175965.1.9899 WP_000175965.1.99057 WP_000175965.1.99072 WP_000175965.1.99073 WP_000175965.1.99083 WP_000175965.1.99097 WP_000175965.1.99098 WP_000175965.1.99164 WP_000175965.1.99184 WP_000175965.1.99197 WP_000175965.1.99198 WP_000175965.1.99215 WP_000175965.1.99219 WP_000175965.1.99255 WP_000175965.1.99267 WP_000175965.1.99276 WP_000175965.1.99278 WP_000175965.1.99320 WP_000175965.1.99327 WP_000175965.1.99339 WP_000175965.1.99370 WP_000175965.1.99426 WP_000175965.1.99456 WP_000175965.1.99469 WP_000175965.1.99490 WP_000175965.1.99493 WP_000175965.1.99531 WP_000175965.1.99561 WP_000175965.1.99577 WP_000175965.1.99613 WP_000175965.1.99626 WP_000175965.1.99630 WP_000175965.1.99637 WP_000175965.1.99646 WP_000175965.1.99657 WP_000175965.1.99660 WP_000175965.1.99712 WP_000175965.1.99747 WP_000175965.1.99813 WP_000175965.1.99824 WP_000175965.1.99858 WP_000175965.1.99889 WP_000175965.1.99924 WP_000175965.1.99958 WP_000175965.1.99961 gi|56416334|ref|YP_153409.1| gi|161617870|ref|YP_001591835.1| gi|452121739|ref|YP_007471987.1| gi|383499113|ref|YP_005399802.1| gi|482907091|ref|YP_007905651.1| gi|197248593|ref|YP_002149501.1| gi|409248258|ref|YP_006888947.1| gi|525827970|ref|YP_008250705.1| gi|197365257|ref|YP_002144894.1| gi|378991819|ref|YP_005254983.1| gi|538365137|ref|YP_008508422.1| gi|525948558|ref|YP_008310200.1| gi|16767801|ref|NP_463416.1| gi|528817649|ref|YP_008358852.1| gi|224586381|ref|YP_002640180.1| gi|378702391|ref|YP_005184349.1| gi|194450381|ref|YP_002048580.1| gi|194442414|ref|YP_002043801.1| gi|549481630|ref|YP_008616152.1| gi|379703800|ref|YP_005245528.1| gi|378453542|ref|YP_005240902.1| gi|525856401|ref|YP_008259200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]