SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161612334|ref|YP_001586299.1| from Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161612334|ref|YP_001586299.1|
Domain Number 1 Region: 48-356,437-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.77e-63
Family Type II chitinase 0.00021
Further Details:      
 
Domain Number 2 Region: 368-435
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000855
Family Chitinase insertion domain 0.0041
Further Details:      
 
Domain Number 3 Region: 643-697
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000726
Family Carbohydrate binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161612334|ref|YP_001586299.1|
Sequence length 699
Comment hypothetical protein SPAB_00022 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
Sequence
MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNKYKNSTTKPKVFGYYT
DWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITGFRKIDTEDRDVVAEAAAL
CGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQSNAKGLLGALRDMQAKAKAAG
HTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQFPMFSEVDIDWEYPNNEGA
GNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVTTIFDYAKVKDLMAAGLYGI
NLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLLAEGFSADRINIGYAGYTRNA
RQVEIESLSPLKGSYNPSSGPTTGSFESGTSEWYDVIYSYLDLENQKGRNGFNVYTDQVA
DADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVFTWTIDQDNGVLVNAVREGLGYE
IESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAPKAAIELMVVGGSTVQLSGAGSSD
EDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVSEKTAFQFTLFVRDCYNEPSSQQRFVL
TAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPAEDDTPADDKTSPYAQWDASTVYGANWG
SFEIVSWKGHNYQVKWWSMGDQPDLNCGVGGAWTDLGAY
Download sequence
Identical sequences WP_000235800.1.70914 gi|161612334|ref|YP_001586299.1| CP000886|CDS_17957-20056 272994.SPAB_00022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]