SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161507095|ref|YP_001577049.1| from Lactobacillus helveticus DPC 4571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161507095|ref|YP_001577049.1|
Domain Number 1 Region: 7-82,175-355
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.61e-50
Family Bacterial dinuclear zinc exopeptidases 0.00027
Further Details:      
 
Domain Number 2 Region: 72-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 4.27e-21
Family Aminopeptidase/glucanase lid domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161507095|ref|YP_001577049.1|
Sequence length 360
Comment aminopeptidase I zinc metalloprotease [Lactobacillus helveticus DPC 4571]
Sequence
MQKEQEIQMLKEFSDANSTSGFEEEFVKLFTSYAEKTANIEVDGMLNVYASKKENKGDRP
VIQLDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALKVKVRNRDGEYIPGVVATKP
PHFMTAAERNNVPDVVDMSIDVGSSSREETIKDYKIDTGCPIFVDVKCEYHEKSGLFFGK
DFDDRFGAGAMIDVLDNLKGEETNFDVVAALSSQEEVGLRGAYVTARKVKPDLCLVLESC
PADDTFTPDWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACDLADKNNIPYTRSVRTGGGQ
DGAAIYYENGAPTIVIGIPVRYEHSPYCFSSYKDFKASVDLATAIIRDITQEKLDSFKKF
Download sequence
Identical sequences A0A1B2IT35 A4UAE6 A8YU20 F3MR39 U6F3W8 U6FKA9
gi|161507095|ref|YP_001577049.1| 405566.lhv_0585 WP_003633113.1.1843 WP_003633113.1.19265 WP_003633113.1.346 WP_003633113.1.40367 WP_003633113.1.42949 WP_003633113.1.48628 WP_003633113.1.50299 WP_003633113.1.70034 WP_003633113.1.87032 gi|525707065|ref|YP_008236078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]