SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161507729|ref|YP_001577690.1| from Lactobacillus helveticus DPC 4571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161507729|ref|YP_001577690.1|
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily Formyltransferase 2.09e-62
Family Formyltransferase 0.00000431
Further Details:      
 
Domain Number 2 Region: 206-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.73e-26
Family Post formyltransferase domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161507729|ref|YP_001577690.1|
Sequence length 315
Comment methionyl-tRNA formyltransferase FMT [Lactobacillus helveticus DPC 4571]
Sequence
MVTSVIFMGTPEFSVPVLEGLIKNNYEIKAVVTQPDKKVGRKQKITKTPAKIAAEKHDLP
VFQPVKLSGSEEMQQVIDMHADLIVTAAYGQFLPTKFLKSVKIAAVNVHGSLLPKYRGGA
PIQYSLINGDAETGITIMEMVKKMDAGDIYSQKAIKIEPDDNAGTLFSKLSIVGRDLLLE
TLPSIIDGSIKKIPQDPDKVVFSPNITKEQERIVPTMTATEANNMIRALNPDPGAYMMLE
GKRFKVWKAEVAKDSTDLKPGCVVANKGRFAISFADGTVLNLLEVQPSGKKKMDIKNFLN
GQGSKFAPGEEIVDK
Download sequence
Identical sequences A8YVW2
405566.lhv_1405 gi|161507729|ref|YP_001577690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]