SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161507805|ref|YP_001577769.1| from Lactobacillus helveticus DPC 4571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161507805|ref|YP_001577769.1|
Domain Number 1 Region: 405-711
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.33e-124
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000419
Further Details:      
 
Domain Number 2 Region: 199-391
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.14e-68
Family Inosicase 0.0000179
Further Details:      
 
Domain Number 3 Region: 1-194
Classification Level Classification E-value
Superfamily Formyltransferase 1.83e-51
Family Formyltransferase 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161507805|ref|YP_001577769.1|
Sequence length 711
Comment phosphoribosylaminoimidazolecarboxamide formyltransferase [Lactobacillus helveticus DPC 4571]
Sequence
MKIAILASGNGTNFEVLTKKFQAGEIPGTEALMFCNHPNAPVIKRAQRLGIPYETFSVKE
CGSKQAYESRLLKVLKEYKIDFIILSGYLRVVGSTILNEYPDSIVNLHPALLPKYPGLNS
IARAFEDYQRGLIDKTGVTVHFIDARLDHGPIIAQKAVPIYPDDTEETLETRVHETEHEL
FPMAVSEVIQKRMKRGNKVKRALVSVSDKTNLVPFVKGLVENHYEIISTGGTKKKLDEAG
IKTISVEEITGFPEILDGRVKTLNPYIHGGLLAERDKPEHMKTLEKLNIHTIDLVCVNLY
PFKQTIEKPNVELADAIENIDIGGPSLLRAASKNYASVTVVTDQADYDRVLKEITENGDT
NLKTRAELAAKVFRTTAAYDALIAEYLTKQTGLEDPEKLTLTYDLKQRMRYGENSHQKAW
LYEDALPKKFSILQAEQLHGKKLSYNNIKDADEALRAIREFQAEPTVVAMKHMNPCGIGR
GKTLEEAWDRAYEADSISIFGGVIALNRKVDLATAKKMHKIFLEIVIAPGFDDDALAVLE
KKKNIRLLQLDFSHENEPVRYETVSVMGGLLMQEQDVLNENVADWKCVTDVKPTEQQLKT
MMFALKAVKHTKSNAIVVANNERTLGVGAGQPNRIDSAKIAVKHAGEAIDNTAVMSSDAF
FPFGDCVEYAGKHGIKAIVQPGGSVRDQESIEAANKYGIAMVFTGYRHFRH
Download sequence
Identical sequences A4ZH18 A8YW82 U6FJB4
405566.lhv_1526 gi|525707777|ref|YP_008236790.1| gi|161507805|ref|YP_001577769.1| WP_012212085.1.1843 WP_012212085.1.48628 WP_012212085.1.6900 WP_012212085.1.87032 WP_012212085.1.99011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]