SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284030719|ref|YP_003380650.1| from Kribbella flavida DSM 17836

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284030719|ref|YP_003380650.1|
Domain Number 1 Region: 12-290
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.35e-65
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284030719|ref|YP_003380650.1|
Sequence length 563
Comment cytochrome b/b6 domain-containing protein [Kribbella flavida DSM 17836]
Sequence
MATKELPPPVAWADDRLGLAKLGKKNLRKVFPDHWSFMLGEIALYSFIILLLTGVFLTFW
FKPSMAEIEYQGSYSLLKGLHMSEAYASTLDISFDVRGGLLMRQIHHWAAVLFVASMMVH
LLRIFFTGAFRKPRELNWVIGFGMLFLGIVEGFIGYGLPDDLLSGTGLRITQGMIQASPV
VGTWMSFLIFGGEFPGDDMVPRFFTVHVLLIPGLILALVTVHLILVVYHKHTQYPGPGRT
EKNVVGYPLMPVYMAKAGGFFFVVFGITALMGALLQINPVWLYGPYNPAEVTAGSQPDWY
MGWLEGSVRIMPGFESEFWGITLSWNLIIPALIVPPAFVTLVALYPFIEQWITGDKREHH
LLDRPRNVPTRTGIGVAFMTFYGLLWIGGGNDLIATHFGLSLNSVTWFLRFAVFLGPIFA
FWVTRRIAISLQRADNERLLHGLESGVIMRSPDGEYTEKHTPISTYEAYELTARDRVEPL
EIGPETDDNGVAAPRRGLTKIRAALSRFYFADAVQKPTREEIEQAHAHGHDDHAELGQSG
DVHSVTGTVEVDDETAREQISKR
Download sequence
Identical sequences D2PZ57
gi|284030719|ref|YP_003380650.1| WP_012920407.1.69711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]