SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284033557|ref|YP_003383488.1| from Kribbella flavida DSM 17836

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284033557|ref|YP_003383488.1|
Domain Number 1 Region: 17-292
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 9.26e-42
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000587
Further Details:      
 
Domain Number 2 Region: 257-397
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000000000229
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284033557|ref|YP_003383488.1|
Sequence length 493
Comment cytochrome b/b6 domain-containing protein [Kribbella flavida DSM 17836]
Sequence
MSCERPRMRGPACRITKEGRAMHRSWSTLRARVFPDHWSLLFGQIAFYSFVVILLSGVVL
TVFYEPSADHVVYDGPYAPLHGVPMSRALDSTMAITFEVRGGLLMRQVHHWATLIMMAAI
TLHLLRLFFTAGFRRPRRLNWLVVFGLLVVTLGAGLTGTSLPDDMASGTSLAVLDGVLQA
TPFIGSELSALLFGGPFPGDVIAWFYPLHVVVLPAVLVALFVIGAVLALKHKPAQPAGPG
RTEDTVVGRPAIVAAVKSFGLFCFVTAVSLLMAATATINPVWLYGPADPANASAGVGPAW
YLAFLDGSLRLAPGWEFVWWGRTFSLAVLLPVAACTLFLALVAVYPFLEERLTGDRRDHH
LLERPRDNPTRTGIGVAGITFYGVLWAAAGADTMAVFFQLSVNSLLHVFQVLLILGPPAA
FVITRRLCTGLQERNAGIVQHGIETGQVIRLPDGGYVEKHRPVDAVRRWQLIGASGENRA
IPPTSDVKHDGAA
Download sequence
Identical sequences D2PP93
gi|284033557|ref|YP_003383488.1| WP_012923243.1.69711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]