SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404407901|ref|YP_006690616.1| from Listeria monocytogenes SLCC2376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404407901|ref|YP_006690616.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.24e-48
Family Cytidine deaminase 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404407901|ref|YP_006690616.1|
Sequence length 131
Comment cytidine deaminase [Listeria monocytogenes SLCC2376]
Sequence
MKENNFISLAKQAREFAYVPYSKFPVGAALVTSDDEVVLGCNIENASFGLTNCAERTAIF
KAVSEGKRDFKQLVVVADTDGPVSPCGACRQVISEFCAPDMPVILTNLTGKTATVTVKEL
LPGAFTSEDML
Download sequence
Identical sequences A0A0E0UWQ3 A0A0E1Y598 A0A1E8EEV1
gi|386008234|ref|YP_005926512.1| gi|217964391|ref|YP_002350069.1| WP_003730437.1.100060 WP_003730437.1.100651 WP_003730437.1.100835 WP_003730437.1.11633 WP_003730437.1.12634 WP_003730437.1.13234 WP_003730437.1.19626 WP_003730437.1.22383 WP_003730437.1.23419 WP_003730437.1.25788 WP_003730437.1.26138 WP_003730437.1.26166 WP_003730437.1.2662 WP_003730437.1.28076 WP_003730437.1.2832 WP_003730437.1.30706 WP_003730437.1.33039 WP_003730437.1.33240 WP_003730437.1.3389 WP_003730437.1.36582 WP_003730437.1.38281 WP_003730437.1.39220 WP_003730437.1.39552 WP_003730437.1.40504 WP_003730437.1.41603 WP_003730437.1.42616 WP_003730437.1.44147 WP_003730437.1.4510 WP_003730437.1.4557 WP_003730437.1.45759 WP_003730437.1.45803 WP_003730437.1.46064 WP_003730437.1.47203 WP_003730437.1.5099 WP_003730437.1.53566 WP_003730437.1.5472 WP_003730437.1.5631 WP_003730437.1.60297 WP_003730437.1.64531 WP_003730437.1.66296 WP_003730437.1.69587 WP_003730437.1.7031 WP_003730437.1.71585 WP_003730437.1.73222 WP_003730437.1.74303 WP_003730437.1.75019 WP_003730437.1.79295 WP_003730437.1.79962 WP_003730437.1.81693 WP_003730437.1.81725 WP_003730437.1.81833 WP_003730437.1.82616 WP_003730437.1.83236 WP_003730437.1.89127 WP_003730437.1.90135 WP_003730437.1.91212 WP_003730437.1.95256 WP_003730437.1.97257 WP_003730437.1.97315 WP_003730437.1.98375 WP_003730437.1.9840 gi|386026835|ref|YP_005947611.1| gi|404407901|ref|YP_006690616.1| 552536.LMHCC_1107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]