SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290477114|ref|YP_003470027.1| from Xenorhabdus bovienii SS-2004

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290477114|ref|YP_003470027.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.15e-41
Family Frataxin-like 0.00000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290477114|ref|YP_003470027.1|
Sequence length 105
Comment protein cyaY [Xenorhabdus bovienii SS-2004]
Sequence
MNDSEFHQLADQLMQRIEEQLDNYDGDADIDCETNGGVMTLTFENGSKIIINRQEPFHQI
WLATKSGGYHFDYQENRWICDRSGNDFLSMLEQSITEQSGESFQF
Download sequence
Identical sequences D3V6J0
WP_012990423.1.58494 WP_012990423.1.67706 gi|290477114|ref|YP_003470027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]