SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260866416|ref|YP_003232818.1| from Escherichia coli O111:H- str. 11128

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|260866416|ref|YP_003232818.1|
Domain Number - Region: 152-184
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0837
Family NfeD domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260866416|ref|YP_003232818.1|
Sequence length 246
Comment putative lateral flagellar protein of basal-body outer-membrane L ring [Escherichia coli O111:H- str. 11128]
Sequence
MSDATLTRLIRPTKAHNSLYLNRQNVKNYLWLVALLPLLSGCESQAILVKKDDAYFAPPK
TEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEESTQSSKQAKTNFGKSNTV
DIGAPTIFSHTKDKLSGSIDANRDFDGSATSQQQNSLRGEITVSVHAVQPNGILEIRGEK
WLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADARISYAGRGALSDANAAGWLTRLFN
HPLFPI
Download sequence
Identical sequences A0A0A8UEC6 A0A0K4SMT7 C8UHD4 I2URA5
585396.ECO111_0278 gi|260866416|ref|YP_003232818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]